diff --git a/.speakeasy/gen.lock b/.speakeasy/gen.lock
index 4249b4b3..b851bb66 100644
--- a/.speakeasy/gen.lock
+++ b/.speakeasy/gen.lock
@@ -1,19 +1,19 @@
 lockVersion: 2.0.0
 id: c48cf606-fb42-4a45-9c23-8f0555307828
 management:
-  docChecksum: 8dd32184dc771115ba5e79b3c70e7f6f
+  docChecksum: 96a7604dc9ce6ef1e0eaa83b29412525
   docVersion: 1.0.0
   speakeasyVersion: 1.680.0
   generationVersion: 2.788.4
-  releaseVersion: 0.10.0
-  configChecksum: 00a97c5bcdbddf7e591c0a1d7a45e98e
+  releaseVersion: 0.10.1
+  configChecksum: b1687c127d87a1ac114b35dd9b492f3c
   repoURL: https://github.com/OpenRouterTeam/python-sdk.git
   installationURL: https://github.com/OpenRouterTeam/python-sdk.git
   published: true
 persistentEdits:
-  generation_id: b6cb6701-b1ae-453f-beb8-2064f09433f4
-  pristine_commit_hash: ed0a00c99b7b3b76ed1de023bc8174696435c2cd
-  pristine_tree_hash: a5b3d8dc9253bb236d709d9f365f5766595d820b
+  generation_id: 09c9c275-90ba-4bc5-979c-612dbfedc691
+  pristine_commit_hash: 42cfd0e1adcd2d472320824a1a9009ea91f3d467
+  pristine_tree_hash: 58faa5c93ed20fcc33e9ba21043cbfb9c5839a16
 features:
   python:
     acceptHeaders: 3.0.0
@@ -118,8 +118,8 @@ trackedFiles:
     pristine_git_object: 123091224cbc4d87e2e01748e013618f2d142632
   docs/components/advisorreasoningeffort.md:
     id: 8b65bf21bf5d
-    last_write_checksum: sha1:ffd01ce6c48ad3d25fb92083622f94c855ed2dea
-    pristine_git_object: 70c97a14813005cfafcc7e2d132921d3e95fb7bc
+    last_write_checksum: sha1:ae1a31169657770ac54bd15b8b9ba99dec447546
+    pristine_git_object: 8828292d4f0692af00fefc00ae0a702cb151d2f1
   docs/components/advisorservertoolconfig.md:
     id: 9a630ec9486f
     last_write_checksum: sha1:b01e3db43dd70ddca3a7bb093b99f5b14c669835
@@ -152,6 +152,14 @@ trackedFiles:
     id: 11b3c6c877d0
     last_write_checksum: sha1:4d8fae9c0de452c9ee796eeab63d242e4feb8497
     pristine_git_object: 4840df7f7005389811fae7c8868ad8d6c1efcd18
+  docs/components/anthropicadvisormessageusageiteration.md:
+    id: 33186ccd38ac
+    last_write_checksum: sha1:85b1ab8c5a0caba0d812a49020e86c3e4e4e9a08
+    pristine_git_object: fb1fb2c3c092a43a6f03f4b264d71641bd0e7446
+  docs/components/anthropicadvisormessageusageiterationtype.md:
+    id: f57e902db2d1
+    last_write_checksum: sha1:dddea52debf78713faf29d2538ebb770389ec3e5
+    pristine_git_object: c91caf36632b4be80f9ee056c70353060066eb7a
   docs/components/anthropicallowedcallers.md:
     id: 11ad7b23165a
     last_write_checksum: sha1:25cf3f22c4aec1a2dad1c12dd83d5ac9681386c5
@@ -228,6 +236,14 @@ trackedFiles:
     id: 9a62f0c12dea
     last_write_checksum: sha1:d6f2b7a37400b47dc5fe09582e4a1c386efd5f64
     pristine_git_object: 1d4dc34466805c06bef9a5ea0d4b3e2658d8fbca
+  docs/components/anthropiccompactionusageiteration.md:
+    id: 0fdb4605a989
+    last_write_checksum: sha1:56320c5757e6070820d812140e08b55844c0c387
+    pristine_git_object: 12fda13cd239b66019e9d6ecba71731b99241816
+  docs/components/anthropiccompactionusageiterationtype.md:
+    id: 05adaf701f26
+    last_write_checksum: sha1:73792e3e037989d145d95059d9926d9cca0b09fa
+    pristine_git_object: 8b38e51d69691041d5c05c3fd3f6b7e0d400fce9
   docs/components/anthropicdocumentblockparam.md:
     id: 0c8300a9f979
     last_write_checksum: sha1:96771cf30db36eb18111c9600fda87cb6e446ec2
@@ -288,6 +304,18 @@ trackedFiles:
     id: c1ed4899ff43
     last_write_checksum: sha1:c30ae212332ee1793cfdf928f5529f02f57fba08
     pristine_git_object: 07b76dbfef3ae2fa73a2c8a347aaec4a2c2db250
+  docs/components/anthropiciterationcachecreation.md:
+    id: 3a99c1a33f1b
+    last_write_checksum: sha1:c6fd763c2cebfbba0a36f8f6200ff6974f702e4b
+    pristine_git_object: 55371b59cf7faa5425c4207b1adb658830bbd7d8
+  docs/components/anthropicmessageusageiteration.md:
+    id: 161b60719de5
+    last_write_checksum: sha1:6620e05e3214198239b7dc56b085630726d6b21b
+    pristine_git_object: 3cb3b43e9fbd0f5cab636b5b48b0c80dedae1839
+  docs/components/anthropicmessageusageiterationtype.md:
+    id: 3d6e1d90edab
+    last_write_checksum: sha1:9f6d1c4cf939adcd22b792d57ab41cde2c1b18a9
+    pristine_git_object: 7ba4b3470290a6518ddc33a5675daf4a486871b3
   docs/components/anthropicplaintextsource.md:
     id: 889fb950c676
     last_write_checksum: sha1:d8887a9e5aed15b708e69d8073fa6a5563afca5b
@@ -312,6 +340,10 @@ trackedFiles:
     id: 727f596d14b6
     last_write_checksum: sha1:8aac220d2c56349083d624947756e5d459df3b50
     pristine_git_object: 89be471a605fb0c9061d62cd853fa70cea52d88f
+  docs/components/anthropicspeed.md:
+    id: 3391bd502330
+    last_write_checksum: sha1:40c366feb39d4306823c71e112b2c9fb40adca9e
+    pristine_git_object: b523006e867a12653a8e462cd2158e4ff6a5a33f
   docs/components/anthropictextblockparam.md:
     id: 5dc491a109ed
     last_write_checksum: sha1:53c890398ec305cb94ef47dc91ede516284903c0
@@ -348,6 +380,10 @@ trackedFiles:
     id: 45a733d909af
     last_write_checksum: sha1:474ee631bb8dcae59c70180e496431be478cae5f
     pristine_git_object: 675f7fd5e9133893bf44dc86bcd92d1f6dfaad61
+  docs/components/anthropicunknownusageiteration.md:
+    id: 7cd2d2aa995f
+    last_write_checksum: sha1:47e54d3e8225cc69c125c2ab45d0377d8407c36a
+    pristine_git_object: 2f341aed854466929fc7e8c909b771fb276447b0
   docs/components/anthropicurlimagesource.md:
     id: 8ff15dedbdfe
     last_write_checksum: sha1:bab99b78bdc564a6d16910aec71cfc8a15fe5a91
@@ -364,6 +400,10 @@ trackedFiles:
     id: 2fbeab80f950
     last_write_checksum: sha1:8db23a874bd09d9757276589bd1b4d2ab77180e4
     pristine_git_object: 3757423de0c85933d0aadd6bb331862c69b6fbde
+  docs/components/anthropicusageiteration.md:
+    id: 9d04ae0634ed
+    last_write_checksum: sha1:4fcbd0ad911126d09cb0d1c2deb31274f0cfc437
+    pristine_git_object: 0bf1cc48ee7ff861dcd371c0e73aea1cadb50942
   docs/components/anthropicwebsearchresultblockparam.md:
     id: 719c1c8395a3
     last_write_checksum: sha1:21e1935215988acd172e194ff764e3b4c7680733
@@ -488,10 +528,6 @@ trackedFiles:
     id: 40a5f2f0b4f3
     last_write_checksum: sha1:1edafecb76992fb1ef8201d9686a011a805431f2
     pristine_git_object: 335e0104f7f12774a22886876bde455234e7ea9b
-  docs/components/aspectratio.md:
-    id: fc8c3ccdb468
-    last_write_checksum: sha1:573dc4ea5cdec788353f87f49ab48434367d7a56
-    pristine_git_object: 10febe4b549ef241d21e8ec471c5867c4c670f9e
   docs/components/audiourl.md:
     id: 1ad9b13da86b
     last_write_checksum: sha1:9614979c76c9624def8aeecc503aa736c99240a0
@@ -504,10 +540,6 @@ trackedFiles:
     id: a871b7b2af66
     last_write_checksum: sha1:f9df41065f2d4eaf35a8d24a54a3824d17e12284
     pristine_git_object: 350b1e9c7a237364a36740e7737db408de1fba50
-  docs/components/background.md:
-    id: d5d845f5b5f5
-    last_write_checksum: sha1:9221c224fd1b8e9c50e5eda1ed6fe78c47221f96
-    pristine_git_object: 62f0f52d26cf2e28ae868efa254c7dd41a37537b
   docs/components/badgatewayresponseerrordata.md:
     id: f01b062274e6
     last_write_checksum: sha1:7dc1fd7cde5f6810da4b468ecbfa6c5a68d402c6
@@ -596,58 +628,18 @@ trackedFiles:
     id: e6ed8eddbb24
     last_write_checksum: sha1:4b8db8f915f099b89698c93a9dd86fdde32f0d29
     pristine_git_object: 39e37fdadaf320fbd499c345f02b0f248331fa98
-  docs/components/benchmarkpricing.md:
-    id: 1773696fd2fb
-    last_write_checksum: sha1:335d20d71d0225a7b8b3ef222f2433571966fe03
-    pristine_git_object: 335c8e92b6ef64040c2d5d774f8bba265bf98f83
-  docs/components/benchmarksaaitem.md:
-    id: a51a6ebb2653
-    last_write_checksum: sha1:5f32825973fbdb3a88d6ae603d9f342befa17ab8
-    pristine_git_object: 1800438874a9224105018148d4fb38ec29aed892
-  docs/components/benchmarksaameta.md:
-    id: 66665e5cc0cb
-    last_write_checksum: sha1:4015be7186e032526ac628e4e57420410ea86bc7
-    pristine_git_object: 92f3db8c60f8ef464075623dc24a6e20c74d1750
-  docs/components/benchmarksaametasource.md:
-    id: 2aac90c13609
-    last_write_checksum: sha1:218130854d26c4067c6ced560ec4c1393e144174
-    pristine_git_object: 9917ffc03124110df323fa88d5a5026145797eb1
-  docs/components/benchmarksaametasourceurl.md:
-    id: 5775371c2220
-    last_write_checksum: sha1:bfd9917a494e65d372cd3900f5178e37af0580ed
-    pristine_git_object: 79522841c570e593e332ce71c07eb81b23abc230
-  docs/components/benchmarksaametaversion.md:
-    id: 7ff3469b31de
-    last_write_checksum: sha1:e26c09306146670ea424451b18297b96258d29c2
-    pristine_git_object: 9649dd143a7a7d927563c2e5d66d899d4bd4a23d
-  docs/components/benchmarksaaresponse.md:
-    id: 6a2090513e37
-    last_write_checksum: sha1:139fd98981f96576c7ef677d15536be622e5b8fe
-    pristine_git_object: a170b12c3bd7816ed14a2bcf823ad518bb5b10ff
-  docs/components/benchmarksdaitem.md:
-    id: a921b9b462b2
-    last_write_checksum: sha1:51b045b1525937e43d122e7e944e305393957000
-    pristine_git_object: 6ef28c047743208fd9694ff3f5fb6797ed2bec39
-  docs/components/benchmarksdameta.md:
-    id: 396a3643066d
-    last_write_checksum: sha1:33c7867659944bd15b83c41170aa6a2cf6b18726
-    pristine_git_object: 71b87b1e04918ab51469ac90868385b723147734
-  docs/components/benchmarksdametasource.md:
-    id: 2846adb831b8
-    last_write_checksum: sha1:c6a9d05b62027e40294664cd4d60eb54eb638ec4
-    pristine_git_object: 5c7aa0e34088aba458f90c5ef441b84b6cc3201e
-  docs/components/benchmarksdametasourceurl.md:
-    id: 6991d2000ec5
-    last_write_checksum: sha1:10a1e0d6a64580aa4443b35ebd44497fd6720c15
-    pristine_git_object: 0460bd8b38e93aaf2dfee47a96b9e46ef2e3b0d0
-  docs/components/benchmarksdametaversion.md:
-    id: da86e114b298
-    last_write_checksum: sha1:e36c13df0304f6803bae21d80dc888d29c281634
-    pristine_git_object: 8997ff2bb56ee569f15d0d1932b95f00c2674ebc
-  docs/components/benchmarksdaresponse.md:
-    id: f052f6690836
-    last_write_checksum: sha1:d49ff5d719b552043a32a0cde7c36578bb5f1a8f
-    pristine_git_object: d296d588dcc07434b82d1fc1bb60a88486406ded
+  docs/components/billable.md:
+    id: e56cdac5d413
+    last_write_checksum: sha1:98491069a5b43aebf322444078f4484e619feb1d
+    pristine_git_object: 37795867a108149fc17bf3eef278a974b555b979
+  docs/components/booleancapability.md:
+    id: 41eaf33722f3
+    last_write_checksum: sha1:cd411f5fcbd4d577fa2fce0e25585f23c36d4d40
+    pristine_git_object: fdb413c61dcecb4b3a9a746774ca51dbb46907c5
+  docs/components/booleancapabilitytype.md:
+    id: ecb8a3396553
+    last_write_checksum: sha1:51460435490021c79f8cbea257d7321e15b7b743
+    pristine_git_object: 7b69b91002c3e38e6751e581211d9fa17e209ff2
   docs/components/bulkaddworkspacemembersrequest.md:
     id: 12cbe93243c4
     last_write_checksum: sha1:5bc0f5067f2fdd1a05409b18ec723b8b2acb4026
@@ -712,6 +704,10 @@ trackedFiles:
     id: 87fa8b1ac535
     last_write_checksum: sha1:cd5e0704dcc4beb29c8e173b7d73365c27b1cb8e
     pristine_git_object: 4108245a8918a4015e5bd610fd87e8e5f4741ce8
+  docs/components/capabilitydescriptor.md:
+    id: b50896c38c8d
+    last_write_checksum: sha1:08c9bd8d8829a298de0f531b0c1c4d8e0e0f6199
+    pristine_git_object: 5d58663d481701b702e326aa62e86f93295c2f78
   docs/components/chatassistantimages.md:
     id: f1f776b0c4ae
     last_write_checksum: sha1:05697e4bc0690cabd72965d01519102c149f6363
@@ -906,8 +902,8 @@ trackedFiles:
     pristine_git_object: 6c832606b0e983d2efd7cc6e3bec98d70e7fc603
   docs/components/chatrequesteffort.md:
     id: 244b6cbbd2e1
-    last_write_checksum: sha1:232d283adecdffb3fd73e052f4913320c9d0b997
-    pristine_git_object: ed30f437a84f7ae8508545aefa44198935377768
+    last_write_checksum: sha1:f9ce1e4a1c3f705b673808b35750af7b71b158ca
+    pristine_git_object: 26c09f0c5ae097d1373b8e5c721a4606765d5c99
   docs/components/chatrequestplugin.md:
     id: 24a908f99472
     last_write_checksum: sha1:0d96c14c2f1675e1bc3cdea7b70a82385a5bc117
@@ -918,16 +914,16 @@ trackedFiles:
     pristine_git_object: baa1fb1a1f855f0ea648d44b8cb4c52185efe77d
   docs/components/chatrequestreasoningeffort.md:
     id: d91e84590d64
-    last_write_checksum: sha1:e05ffa6a13566055170ad3490b2114c7f8215c70
-    pristine_git_object: ab2eb8e2084efaee1528e74f2de35166d9bbf05e
+    last_write_checksum: sha1:b72a0292fdffaf77b2531a155ca00d6d46405746
+    pristine_git_object: 475f655086e1ec97e9b7aadc35ea4977da9e32dd
   docs/components/chatrequestservicetier.md:
     id: deaf591bec38
     last_write_checksum: sha1:8fa53b0f868c99934b83719b7c0b6b44b1f960eb
     pristine_git_object: 13ae40be5e3c883f88789c3b5b74a3b2da4c85c2
   docs/components/chatresult.md:
     id: 212b0f66efd0
-    last_write_checksum: sha1:0a94cfb0c88a0dbf0f0abc5d83ac6fc6c48051b4
-    pristine_git_object: cc04eadd2f48efd93533a3ddae52ad39e91f5dee
+    last_write_checksum: sha1:f40df693ad2d2d8e156aacb218af394f675bfb89
+    pristine_git_object: 41f82f9576591d048a504f29ca19b148ccca02bc
   docs/components/chatresultobject.md:
     id: 668504931d18
     last_write_checksum: sha1:6d550246aa007a5be94a9788ae4cfdfb75006980
@@ -950,8 +946,12 @@ trackedFiles:
     pristine_git_object: 690d74b67239bf7f423039652aea3741c831137e
   docs/components/chatstreamchunk.md:
     id: 404d264ea22c
-    last_write_checksum: sha1:1353c09378850a9810c39cf3198f0fd5e049f610
-    pristine_git_object: 3c64aec72fb2eb9f0cf6eae975dd9c8bb183c6e6
+    last_write_checksum: sha1:3c68e28cf5abc681f3f4bfe8d80eb67c88a7b73f
+    pristine_git_object: a26112e4d4dbe32037202e62cebf4b7f00342351
+  docs/components/chatstreamchunkerror.md:
+    id: 5a682faf2e52
+    last_write_checksum: sha1:5efe15a9efed62e7599bbc242683b1c57ae7896a
+    pristine_git_object: 8decce73845cdd3c2987890776d16e194d9c08e4
   docs/components/chatstreamchunkobject.md:
     id: 5393918d9606
     last_write_checksum: sha1:0765d94b3d01c811155dce29c20c2ae4bd4abd0e
@@ -1050,8 +1050,16 @@ trackedFiles:
     pristine_git_object: 7eb1791a9153498d5ffffc6b67d3668df59000c2
   docs/components/chatusage.md:
     id: 72cd0c41ec64
-    last_write_checksum: sha1:9a6a709e2ea8f36c1f55afc3ae364917ab787e5e
-    pristine_git_object: 536fc52c1d3dec20dc3dd38e65714da08779e4d3
+    last_write_checksum: sha1:144cb3e4e6a71d58327acf0ff8498eed396ade84
+    pristine_git_object: 1d06874f274e6752279eeff823c9a05b8ee97735
+  docs/components/chatusagecompletiontokensdetails.md:
+    id: fd8b3b9b7ae5
+    last_write_checksum: sha1:16c853c63f5304e52cbf897cb4f67e9d35d3b97b
+    pristine_git_object: e3ccb3e879887bc2406c08c4321435c986a04309
+  docs/components/chatusageprompttokensdetails.md:
+    id: c8b56480e08a
+    last_write_checksum: sha1:28bbd1adcb38e0e57cc2b20e5ed0f26269e39675
+    pristine_git_object: 14e30cda6c43cb27d0316b8d1450c63943115467
   docs/components/chatusermessage.md:
     id: 4ab205b0030b
     last_write_checksum: sha1:4c87fbc12f54bb5b58526949e3f8ea9c161f8cdf
@@ -1108,10 +1116,6 @@ trackedFiles:
     id: 1033dd974aab
     last_write_checksum: sha1:ba3f1ccb85f1193a2523c96199a7e15a4923e5ef
     pristine_git_object: 3616c45038b37d4adc7f0d643f7159853915586d
-  docs/components/completiontokensdetails.md:
-    id: 6b7b08e269a0
-    last_write_checksum: sha1:1731f180f3ed8e9fb0a52137853b0d587f8f703c
-    pristine_git_object: 79c357c837cdd905fc6e73470401f1477f3539b7
   docs/components/compoundfilter.md:
     id: 6c881867d341
     last_write_checksum: sha1:0afec796142bbf1dd29d5ae73e6926bfc46c7ab6
@@ -1448,6 +1452,22 @@ trackedFiles:
     id: 8d84fb41685d
     last_write_checksum: sha1:fcfbe6740c505b263b90f7de5281d4f506922b05
     pristine_git_object: 870296bd3335da46ecdf4ec1722a3d47037a09c9
+  docs/components/debug.md:
+    id: 26a3872bbe78
+    last_write_checksum: sha1:49855ba9878e3a8cab4e48176c1638475824b111
+    pristine_git_object: 57d0211ffc7883793b06207fd2909f05117f42e1
+  docs/components/debugevent.md:
+    id: fc88265fcb2e
+    last_write_checksum: sha1:5797649b9dec8e67a019a339786d29067bc6c1d0
+    pristine_git_object: 190177ccf64727feae565ad9930ca71cf0c5bc1f
+  docs/components/debugeventtype.md:
+    id: 8e17e2235c87
+    last_write_checksum: sha1:981773f91d37ee4d920a01c457995b4fe2085f69
+    pristine_git_object: c70c1ce547e7a377caca25eac9e55d5cac10c165
+  docs/components/defaulteffort.md:
+    id: 08dabde07c1d
+    last_write_checksum: sha1:0a1d4ee947c22010f9bb2cb66a52a0bbb2011e00
+    pristine_git_object: 871219eaf7153f1027be70d26b1f667444a6fb17
   docs/components/defaultparameters.md:
     id: a84477afcaec
     last_write_checksum: sha1:a20e8b576e341dbcdb91884b8fc83cf4316ab106
@@ -1556,10 +1576,6 @@ trackedFiles:
     id: 099ed6a1de82
     last_write_checksum: sha1:41580565bc483b2ca1cdb981e15d324f8060f504
     pristine_git_object: 8463c0cdd55e1d75e23e3d7362f0dbfeca1985c0
-  docs/components/elobounds.md:
-    id: a274cbd2e74e
-    last_write_checksum: sha1:516698f2d4c018cb0e999981d34f4d4d782a2382
-    pristine_git_object: 101203ebc6a380cabc8c7767c3d9a775bbf16dda
   docs/components/endpointinfo.md:
     id: 98e0e75e1121
     last_write_checksum: sha1:5563b32279aeafa2725d1547df1d0f517e53789d
@@ -1572,14 +1588,18 @@ trackedFiles:
     id: 8643237270dc
     last_write_checksum: sha1:945606bc29cd884375a5c9404786df5e726e67a0
     pristine_git_object: dd8900571dc033720f7ae045e3ea0592d4588c4c
+  docs/components/enumcapability.md:
+    id: 03f3a8a22c9d
+    last_write_checksum: sha1:3e87b13cadc0c69789c6a5f9e0d5163501615711
+    pristine_git_object: ab110208b2603a762628911c9952a34dce75a38a
+  docs/components/enumcapabilitytype.md:
+    id: eb85df42d2a1
+    last_write_checksum: sha1:c86722cdb14ed7a6de6574259b4a44fbcfb3f104
+    pristine_git_object: 4c3f22bb88bfc6e30be791285a94861ae272c39c
   docs/components/environment.md:
     id: 29e78fad01ee
     last_write_checksum: sha1:532d3cc7bb12231a96be78b25f9b5b06e1db3218
     pristine_git_object: e58da65457bd71885289a77f054ae63189dc77d9
-  docs/components/error.md:
-    id: 786c3bb44e8d
-    last_write_checksum: sha1:5ed43ad1b7a3ad8ed0d2198be4edb3a469c4910c
-    pristine_git_object: a64dcf8737b1b8fd7dd8d3be0d9ca92f3febb59d
   docs/components/errorcode.md:
     id: 8444c861d257
     last_write_checksum: sha1:8afa60d8ed19ab173c806f80bbe6fee0f40daf5a
@@ -1592,6 +1612,10 @@ trackedFiles:
     id: c66a1a2560ef
     last_write_checksum: sha1:75e5cd528e6faeee349e685da1810190643ae17d
     pristine_git_object: b3410e67c37edd66f60b0f2364e0d858abe3bd88
+  docs/components/event.md:
+    id: 4bd48e5ca177
+    last_write_checksum: sha1:943311c8ce583f0b6395a3a71b3c2c8d3ca1d533
+    pristine_git_object: 951557e29494624a811928ce287ea536a39d14c2
   docs/components/failedmodel.md:
     id: 352428b99ca5
     last_write_checksum: sha1:92ead534bbde5d3029a41bcdae5d381d85ece301
@@ -1890,12 +1914,12 @@ trackedFiles:
     pristine_git_object: 6e9d365f8f2f48bd6e425c4bc196d5572b5c9828
   docs/components/fusionservertoolconfig.md:
     id: bc9b9f7ae08b
-    last_write_checksum: sha1:49f4e5047fad8c20098c6500d17ee3d883f41c56
-    pristine_git_object: b243b885cd9572d61cb63f2364f924a0751b19fa
+    last_write_checksum: sha1:6868fa48d73ab5cf7c839b160d271c9d0d80ed23
+    pristine_git_object: e0056de3776d8d0e790220f36e19e8ccf2679329
   docs/components/fusionservertoolconfigeffort.md:
     id: 897b52512b1c
-    last_write_checksum: sha1:3d2f3e019eee3c6bf4aedba909f7a92740d21225
-    pristine_git_object: c7578213d3c65bdf579321a08c84d8f4c1de59a6
+    last_write_checksum: sha1:2bb8798736eeb5504615ae93293601042af679cd
+    pristine_git_object: 3e3f9ac35f973801cf9cc5be1ac29e9916074377
   docs/components/fusionservertoolconfigreasoning.md:
     id: 349d14075b51
     last_write_checksum: sha1:9c650a736d7b96f193e6d24da5e82b7aa24ba39e
@@ -1976,6 +2000,10 @@ trackedFiles:
     id: 0b156eedfb3c
     last_write_checksum: sha1:09e8882a3b53c99f85610eaddf2cb8ab788527d4
     pristine_git_object: ae78526d566a4cc55996515044cebeb36166f7fe
+  docs/components/imageendpoint.md:
+    id: 128d4f4eda2b
+    last_write_checksum: sha1:775911a83810fc45a4107c5c1cf6e2677ec23788
+    pristine_git_object: d062f647fd27433d0a106eafc0ea17553a468fd8
   docs/components/imagegencallcompletedevent.md:
     id: c26bc1b3854e
     last_write_checksum: sha1:487f2664906ce2bf995e5f33739ea14944d4a20b
@@ -2008,10 +2036,62 @@ trackedFiles:
     id: c007465f6177
     last_write_checksum: sha1:c14e2e12eb49cf4445fdda2e2f400a8ea849d058
     pristine_git_object: 841d9210013aa9eac24702237c16d0aca12a985f
+  docs/components/imagegencompletedevent.md:
+    id: 43f5718fe2c2
+    last_write_checksum: sha1:650b4752a08040461390f10b30ceda0b5df1f0bb
+    pristine_git_object: 33b0307acdb1bf725cd89c5adb39eb3e110ff876
+  docs/components/imagegencompletedeventtype.md:
+    id: 84e07b20590e
+    last_write_checksum: sha1:2c301f011ef720a3d8c561c8823bcfb982934d16
+    pristine_git_object: a55fc00acede523cca610d646093deddf558b168
+  docs/components/imagegenerationrequest.md:
+    id: e9d8e330fcaa
+    last_write_checksum: sha1:dddd107f6e4742d210cf232c0f790ab89a767883
+    pristine_git_object: 554e79c04d916e93d56da8434958640791e87fea
+  docs/components/imagegenerationrequestaspectratio.md:
+    id: 4362d9221e46
+    last_write_checksum: sha1:42f4b0d20c677cb8eeed1da4be0ba99b3949a092
+    pristine_git_object: 5fd5856c0c84516b9cafb31efc69c9dffde3cd6d
+  docs/components/imagegenerationrequestbackground.md:
+    id: c71873b68e38
+    last_write_checksum: sha1:d19360cc58475f3df142bbdf4e0cc05b2e402f8d
+    pristine_git_object: e6a05256245f0e61a844854a79e3df7b614660e7
+  docs/components/imagegenerationrequestoptions.md:
+    id: c0b61720c268
+    last_write_checksum: sha1:77a8bca9b78e6d259464e8d1a199cf250991e66a
+    pristine_git_object: 17f5d804b67c93dba48fd1ebd1d17099a464c4ab
+  docs/components/imagegenerationrequestoutputformat.md:
+    id: e2b7dc215866
+    last_write_checksum: sha1:4b9a9b87036845d3ac7d1750f9f23ed0a89d9151
+    pristine_git_object: 6120e0a8081f9a2ed9a0c3606f7fe3d45d4e6f81
+  docs/components/imagegenerationrequestprovider.md:
+    id: 2718a263ac9d
+    last_write_checksum: sha1:cd79a69707ee0a6040570128b20dc122f9561c37
+    pristine_git_object: b61121191366b1bc3021939e983e136588a2ecf8
+  docs/components/imagegenerationrequestquality.md:
+    id: 1c832458c677
+    last_write_checksum: sha1:cb4331f66f1295a6b046c4575e443b9ca84d6939
+    pristine_git_object: 4e7aef948aa95a900e52687840862e48882de964
+  docs/components/imagegenerationrequestresolution.md:
+    id: d1e0d8c6d7ca
+    last_write_checksum: sha1:3459b30c68397ab41b467b9c933df24b8922c917
+    pristine_git_object: 6da119988a6c4ed655b1ba1698a8e77dc6a3014a
+  docs/components/imagegenerationresponse.md:
+    id: ad79bc29b985
+    last_write_checksum: sha1:adb46b786be5d9b720945c8cb714fd661a86d629
+    pristine_git_object: a921a4c4cd5f75c926ba03263469315a14537160
+  docs/components/imagegenerationresponsedata.md:
+    id: 6a33b08924d8
+    last_write_checksum: sha1:ddb47b0ec0e5854effe56ca1989b8206e0d7b56a
+    pristine_git_object: c80a572552036e143d3b8827a84011d5f62083e9
   docs/components/imagegenerationservertool.md:
     id: 0ddff7f46134
-    last_write_checksum: sha1:b46e044c36e1518d95bb94572e43311da69a5b6d
-    pristine_git_object: e38b5c19b6356f255783dfacea66b45418679e21
+    last_write_checksum: sha1:02ee9876107578bd27eb9ba811439416b9e76a63
+    pristine_git_object: f8fc06e67da93583c9faf5a5e6e5042064c5c2c3
+  docs/components/imagegenerationservertoolbackground.md:
+    id: e9f2d4d3c83a
+    last_write_checksum: sha1:4c13d167e30bd2452b0945864c06a4d29eed747f
+    pristine_git_object: 0e17cf5b4827e7a189c3b3ca6d11f778a870b648
   docs/components/imagegenerationservertoolconfig.md:
     id: 4086d42eed1b
     last_write_checksum: sha1:4be4af2bb484ca26d779f052da6a645dcb4d912c
@@ -2028,6 +2108,14 @@ trackedFiles:
     id: 420c811d4561
     last_write_checksum: sha1:6b8ce48b3e662ea3bfd8a9be737e43cd1b051e39
     pristine_git_object: 30c86424343ade04282d92095ea92ebf6635ac81
+  docs/components/imagegenerationservertooloutputformat.md:
+    id: d7955b88c967
+    last_write_checksum: sha1:2478be8f2137bfc7e30dbe5a6a85b57afa2755f9
+    pristine_git_object: a020209bb1b86f2ad5d8820bcdf792c2e6a6e56c
+  docs/components/imagegenerationservertoolquality.md:
+    id: b8b7bc3e3b90
+    last_write_checksum: sha1:63f903c60036f9c9a3edbcd830bd57c55328ceeb
+    pristine_git_object: 75a4cf8af255afbdad2a25e9291e3afaf880d235
   docs/components/imagegenerationservertooltype.md:
     id: 5d4b6d6b41ce
     last_write_checksum: sha1:125bdc6395723e8fcdd82be5d88e04916b8641fd
@@ -2036,6 +2124,70 @@ trackedFiles:
     id: 20f9a63cfff4
     last_write_checksum: sha1:999c6f63846a5521309becac23012ed04d18f9eb
     pristine_git_object: 22e0541cab57771537bd791307029b628e7151ec
+  docs/components/imagegenerationusage.md:
+    id: cc38c041200d
+    last_write_checksum: sha1:9987bcb7e94ecd6bbe04bcfd6c12313ccbb7ec81
+    pristine_git_object: 3e69647aa497f0b7d030d6cde11782c1b0d20a38
+  docs/components/imagegenerationusagecompletiontokensdetails.md:
+    id: 6a9505656f3e
+    last_write_checksum: sha1:3a8ab71ac995be890cd743b4414d964340423719
+    pristine_git_object: b11137adab9011a40f4a5df6f340af6137b283a0
+  docs/components/imagegenerationusageprompttokensdetails.md:
+    id: b3e9b815a8d9
+    last_write_checksum: sha1:86c40da9dcd83869181810175843195be4dc264c
+    pristine_git_object: bc851c33c247b050c60d463c1c8331be6510e7fa
+  docs/components/imagegenpartialimageevent.md:
+    id: 7cb3bb2545b0
+    last_write_checksum: sha1:cc556150e26bd4466e955c0e71e9b21273f396b0
+    pristine_git_object: 4ae2746c47459dab9adb9bfa949a4bb8b4fc58c7
+  docs/components/imagegenpartialimageeventtype.md:
+    id: 96f18837a787
+    last_write_checksum: sha1:4ec9ffdbd40cafee34f51514e57c2fbc02348970
+    pristine_git_object: 874960df1e1e77d552ec0c400f4802ef2492ead3
+  docs/components/imagegenstreamerrorevent.md:
+    id: 7f87611c8219
+    last_write_checksum: sha1:b80d7feb4f647b58d24637f811717a9f2cb4da49
+    pristine_git_object: 25fa3a5e9bc19b2c7f034b0097434e48e4d6a21e
+  docs/components/imagegenstreamerroreventerror.md:
+    id: f563003ebf93
+    last_write_checksum: sha1:738e09a08778523ee61551fc92dba743e5188512
+    pristine_git_object: 05a27840bf348b3b6faa675330c8374272e83089
+  docs/components/imagegenstreamerroreventtype.md:
+    id: 0960d2a494df
+    last_write_checksum: sha1:029b8554dac0fe80200b521707d848102b887a12
+    pristine_git_object: 0d7e98938d1d3955a470eb109413d03b2319da40
+  docs/components/imagemodelarchitecture.md:
+    id: 664721f94572
+    last_write_checksum: sha1:b4755ec3785f84b9292c004bb4502eedbac95416
+    pristine_git_object: 4c9d858d399c4b690e0ae62268bb93868b204fc3
+  docs/components/imagemodelendpointsresponse.md:
+    id: 29ef44f50783
+    last_write_checksum: sha1:bff6a52c9ef77f4ba2287d7682287e796cb059fd
+    pristine_git_object: c10719481269bc587d7116bb9d0e7edad72a657c
+  docs/components/imagemodellistitem.md:
+    id: 32a773c24ad0
+    last_write_checksum: sha1:57ba7d06ca6f0a4aeb770bf0057dce5914e19672
+    pristine_git_object: 0402259ab80680643074eda229d5d06b7b0cdcd6
+  docs/components/imagemodelslistresponse.md:
+    id: aebec95b3fdb
+    last_write_checksum: sha1:f45a3bde3fb4753553bd652ea13b39b385b3c1d3
+    pristine_git_object: 02cf2f7805c226f04a7137b6a7a5d2172cbcdfdc
+  docs/components/imageoutputmodality.md:
+    id: c88658d6160a
+    last_write_checksum: sha1:6f11a36268e2b1910e5d3f62244a71638b6a4345
+    pristine_git_object: 0cd471e8af6f05e30fe6ada9ea442f38e710630e
+  docs/components/imagepricingentry.md:
+    id: ffea76db0419
+    last_write_checksum: sha1:8ac8f6a3131bf6ef1804ebacca11103bba4905d2
+    pristine_git_object: 638fcc2a0bed2741bdbaf8472cf6e127dbe21028
+  docs/components/imagestreamingresponse.md:
+    id: b50cb74438a9
+    last_write_checksum: sha1:0bd7f6e18c2e7f51db16b38982320bf915ef23df
+    pristine_git_object: fc57cc2c190c12caa1ca878c9545d00a67c72ca7
+  docs/components/imagestreamingresponsedata.md:
+    id: c072b0eb2c02
+    last_write_checksum: sha1:a3e05c53987d0149bdf23251f29f1b433008b818
+    pristine_git_object: 78dab52333e65bcadb03fe4d69d176f3259e4561
   docs/components/incompletedetails.md:
     id: 4ce388faaac0
     last_write_checksum: sha1:3aad9a98e1bb15a540b9f8307a1c9524432e7959
@@ -2522,8 +2674,8 @@ trackedFiles:
     pristine_git_object: d5bbdc95f658be46eebf13f0ba8b9ae3716f72e2
   docs/components/model.md:
     id: 673ad57400cd
-    last_write_checksum: sha1:517cbce221606bacb2cab7b97e53d316d09a5f17
-    pristine_git_object: 8ce3d9d7c9ddc7c270da3a39df079148aa7ff207
+    last_write_checksum: sha1:ea20bf9ca8f49a181142f516f1b36758cf5ceac6
+    pristine_git_object: edb000fc276b3eec0dbe0bb1e82c4f5d7a72e8c9
   docs/components/modelarchitecture.md:
     id: 79816051e6e8
     last_write_checksum: sha1:158b04c79b7a32a2d95e3d3fda8fa6da0ab91cd9
@@ -2548,10 +2700,14 @@ trackedFiles:
     id: 74607e6a173d
     last_write_checksum: sha1:445ec227b130763e2509d1a181dd5e3e6d71420a
     pristine_git_object: 317190772f743d2aba63c4dad770827b46688f6a
+  docs/components/modelreasoning.md:
+    id: 47976b46e5b9
+    last_write_checksum: sha1:07deec55fe155257ef07086b6dc2fbc7e012e031
+    pristine_git_object: 306c0aeb39047768e6c79975996240584a97525b
   docs/components/modelresponse.md:
     id: 9d48c3f335b1
-    last_write_checksum: sha1:5d8890c41a9f448341037e9915dd6e93df9140cb
-    pristine_git_object: 2a7433dc87413943d14220ffdfda8b25e59bc9c0
+    last_write_checksum: sha1:442bb6c4d21debbceb5a48a9563b07704983123f
+    pristine_git_object: 2ad6e9dc16fa06d03318e98bc540c7aca0d497ed
   docs/components/modelscountresponse.md:
     id: abdad0c1a02a
     last_write_checksum: sha1:50ae205604eddcbdced268b8cd3e1ac06f0dd7c0
@@ -2618,8 +2774,8 @@ trackedFiles:
     pristine_git_object: 04544acc47732ace2cf93c40a24734e72ab7fbc8
   docs/components/observabilityarizedestinationconfig.md:
     id: dc1d535079ea
-    last_write_checksum: sha1:abb1dd20f7c854e5ef212d78da381740ae160a5d
-    pristine_git_object: a62521fecc1f3c34092879f92859f4020684936d
+    last_write_checksum: sha1:1288b88f495552b356e2f4ddf71440866c6b4d74
+    pristine_git_object: 3e51f13a5a9751ae689488b368edcd4eb47fa408
   docs/components/observabilityarizedestinationtype.md:
     id: 8e8a0fa37466
     last_write_checksum: sha1:ac6b0d3b0f878616a9cfd4c82d3bf5f992176f65
@@ -3036,10 +3192,6 @@ trackedFiles:
     id: 63449f6362da
     last_write_checksum: sha1:11b3d7ad51195be1e48a90e2861633551b9992d5
     pristine_git_object: ffa82a743b58e9352a9dfad57f7a4a94c629944c
-  docs/components/options.md:
-    id: d57f3108a48d
-    last_write_checksum: sha1:5aa4060133c8174e65d08d837c209fc2f250afd1
-    pristine_git_object: bf8723976c27b0315ba0abce902ee5c053f9cbae
   docs/components/order.md:
     id: 16e6ae6962e7
     last_write_checksum: sha1:a060705e562a2f3fc024c4fd8aa80604535b0bc1
@@ -3160,10 +3312,6 @@ trackedFiles:
     id: 706d9134f7f4
     last_write_checksum: sha1:2a870670b74028e5d40aac474e3cb64527a740f8
     pristine_git_object: 52d2d39bfacfe9086893c241a4bc4e22f7d13ddc
-  docs/components/outputformat.md:
-    id: 6699f32fe6fa
-    last_write_checksum: sha1:f02204f21f3fb218890b08c23458c4db9d27b634
-    pristine_git_object: 7f5c5453ac49de51f495c9bc9ab491a02025e92b
   docs/components/outputfunctioncallitem.md:
     id: a0b3dcf93469
     last_write_checksum: sha1:30c6f678351da68f90cc92d45d6c477ab0aee6a4
@@ -3600,10 +3748,6 @@ trackedFiles:
     id: 285ea7802dcd
     last_write_checksum: sha1:0fff83f064f6699f5a86c5068423c646a9fca69e
     pristine_git_object: 02d5dcdfc5bec22a67a803487f4758df68ba098e
-  docs/components/prompttokensdetails.md:
-    id: 58d2af57c508
-    last_write_checksum: sha1:900904dec588ecd97ed17fc0d99896082494f729
-    pristine_git_object: ecc924e0faf698d142621fce07381ec15ce6d725
   docs/components/providername.md:
     id: fe24a77d9911
     last_write_checksum: sha1:dbadb7842e1e2db16bae5e0fdf3090bf44f9f4f8
@@ -3648,14 +3792,18 @@ trackedFiles:
     id: 9d43651da8ad
     last_write_checksum: sha1:c066038e95bcbaec6cb1eeb3b5657102c37ee5a7
     pristine_git_object: b96d4af729e9e69d041122e88b11e82cd2db8878
-  docs/components/quality.md:
-    id: dd4dd0d7b023
-    last_write_checksum: sha1:6191307209f88c4d94d43a9f9b2e200a2b16cc66
-    pristine_git_object: a09a4498e9247a867f25cb54f1898572125f48af
   docs/components/quantization.md:
     id: 0d17b4a78828
     last_write_checksum: sha1:992ee3fdd0f4e09c9f6e6426c413841fe34a86a5
     pristine_git_object: 7a0574a89d4c7836115ac16571dd32b7d9290914
+  docs/components/rangecapability.md:
+    id: 790774ea2733
+    last_write_checksum: sha1:120397200e2eea9f5f06e4d77329af171e0fd67d
+    pristine_git_object: 869b0a3d3c2bdc63a7e617281c1ac343d85b489e
+  docs/components/rangecapabilitytype.md:
+    id: d1afd4e509b0
+    last_write_checksum: sha1:b591fbd5fa30109a985f7f91b136e52e3b1677ff
+    pristine_git_object: 2bb5777d79c16416dd0d7ab0539a28f37e77d8cf
   docs/components/ranker.md:
     id: 5a14b8d09a01
     last_write_checksum: sha1:56664aff547bdcede5fb21eec2731a58d393c949
@@ -3734,8 +3882,8 @@ trackedFiles:
     pristine_git_object: 31d997aa9e0721cacdebfeb79ce3428d5ec79bf0
   docs/components/reasoningeffort.md:
     id: ea6dba24a061
-    last_write_checksum: sha1:1a34f59ecfdc631ed846c0e33951b52d2a86beae
-    pristine_git_object: 9fb0ddf227e42c634f5c435a2749db2e7effbf45
+    last_write_checksum: sha1:53d8315d1f29bca1071672fbe583cad08f1cec81
+    pristine_git_object: 225df68e53d3632bcd740e4f821d4f14233be403
   docs/components/reasoningformat.md:
     id: c0483881ee4e
     last_write_checksum: sha1:45038411b97c73c37fa000694770b06d13b0eb4b
@@ -3860,10 +4008,6 @@ trackedFiles:
     id: b03f377616f1
     last_write_checksum: sha1:1e7d12b699c50af0d04cce4cb73efe48cf32f49a
     pristine_git_object: 0bb2e7cd4a22f1d0e52d75180639dd9125c0b542
-  docs/components/resolution.md:
-    id: 84d737f84bee
-    last_write_checksum: sha1:606fd74ebc92be927228afd7adefa80e64c47a52
-    pristine_git_object: 596502b2f94707deb347c53015c764525c9ba3b9
   docs/components/response.md:
     id: 2b40822178c9
     last_write_checksum: sha1:385337549929814b68441066e56ed7daa6183344
@@ -3906,8 +4050,8 @@ trackedFiles:
     pristine_git_object: e21193bbab68ee5dfdb0a113e26ba70f82bcab55
   docs/components/responsesrequest.md:
     id: cb5cd99790f3
-    last_write_checksum: sha1:80469fec7c75dcdf77ae2ad4f5bf40cdfedd4397
-    pristine_git_object: 22201e800d4d5cb9759f21c1cd10d72580a93ad2
+    last_write_checksum: sha1:ab9017177687f0f272ff43fa0238172d526878ad
+    pristine_git_object: 9ea0e1056bd1e0adce85cf9c39af993c1aae5e59
   docs/components/responsesrequestplugin.md:
     id: 20da7be12bb9
     last_write_checksum: sha1:0bb97c99ec4b7fd13321427b9aff9a2d8bb6d288
@@ -3964,6 +4108,14 @@ trackedFiles:
     id: beee40001fda
     last_write_checksum: sha1:45b7b8881a6560a468153662d61b99605a492edf
     pristine_git_object: 2e0839d06f821dd97780dc22f202dedf23e4efe1
+  docs/components/servertooluse.md:
+    id: e304ebc583f7
+    last_write_checksum: sha1:99e277666646ff89adce836927c58d9021fa6677
+    pristine_git_object: 2532d4cd15c0a21efce64ce42719d6b24aa0a063
+  docs/components/servertoolusedetails.md:
+    id: b14e315828c5
+    last_write_checksum: sha1:2e4e747062c990a502a208c1c90382305e428fe7
+    pristine_git_object: fb12e181963bb9eada3294d7a605b076f695ab58
   docs/components/serviceunavailableresponseerrordata.md:
     id: 6d65ecfd7ad3
     last_write_checksum: sha1:c0e9357b45a58f3da2d3520b502cec7dae5f3446
@@ -4118,8 +4270,8 @@ trackedFiles:
     pristine_git_object: 0b3d0bcfd7082915b45ef9a4a8e74422857dd665
   docs/components/streamevents.md:
     id: bdfd7bf6c2b0
-    last_write_checksum: sha1:8f15c1a958bc657678852f48a6504c8cc82445a3
-    pristine_git_object: ab79016604959e59d30008817272722fe9c3cec1
+    last_write_checksum: sha1:bc6b66905697ce2589ab6ea247b1e834d6e0bc68
+    pristine_git_object: 639fb4cd758757c7978a545c0373526a2fef01df
   docs/components/streameventsresponsecompleted.md:
     id: 072f9ee89867
     last_write_checksum: sha1:9f33add33825fc28ad93f36c26638728fc66712b
@@ -4198,8 +4350,8 @@ trackedFiles:
     pristine_git_object: 3e49330ffc6e7ae403873cfe3e8297ad188bcafa
   docs/components/subagentreasoningeffort.md:
     id: 068a2b1e59c4
-    last_write_checksum: sha1:6b27ed5774615473f501ec7bf18c1524c99e4002
-    pristine_git_object: fe29f80f29f7137d07401b4d25def11360a70a32
+    last_write_checksum: sha1:6dbeef8db7e15799fd0f87d4965ba5613a388396
+    pristine_git_object: 57b95be94ff3162b0601124a9d6d9b49f49eecaf
   docs/components/subagentservertoolconfig.md:
     id: 07f1740a203f
     last_write_checksum: sha1:3175e6b1db4977f98195f30c6e2391092bc017ff
@@ -4276,6 +4428,10 @@ trackedFiles:
     id: 28a220a73365
     last_write_checksum: sha1:784cb7e75b383ed2c288716830d701f2563feba8
     pristine_git_object: f8c28844eae476d93d80f9bb89812df998fe7988
+  docs/components/timings.md:
+    id: 458f7a6290a7
+    last_write_checksum: sha1:2fb6a4822a5d3046868380d5d1e4a1a6fd096ce4
+    pristine_git_object: dd5a0d0fbd9e962afc1b88cd96cf9f563c356ca3
   docs/components/tokenizer.md:
     id: f1ad3417d8d1
     last_write_checksum: sha1:4223f630f7d880b9288fb654f67817560fb2dbd8
@@ -4524,10 +4680,54 @@ trackedFiles:
     id: 79b657be05c4
     last_write_checksum: sha1:69e58ae8931fc723bbb4aa1212e50b97a83db709
     pristine_git_object: 1db2a3a9378d0eeb5de39f1d6621e69bbb7e0953
+  docs/components/unifiedbenchmarkpricing.md:
+    id: 2c0b1127a84f
+    last_write_checksum: sha1:536d10a0997b62e031564acc91dd3d1dede8ae6b
+    pristine_git_object: 02271ae5d1e6836b02869391fbc7a08df47aaa31
+  docs/components/unifiedbenchmarksaaitem.md:
+    id: aa98383cedbb
+    last_write_checksum: sha1:0c5a943891afc1617252650b539aacda66219cb3
+    pristine_git_object: 12ee0f9d6c843cabbeea35693eef407c7727e818
+  docs/components/unifiedbenchmarksaaitemsource.md:
+    id: a055d68005b2
+    last_write_checksum: sha1:a2d31b611ef768ef91be865e6ad137219baa49c0
+    pristine_git_object: 9c7155b69b81eb5b72455656962cd477716a5527
+  docs/components/unifiedbenchmarksdaitem.md:
+    id: 97ff97a53af6
+    last_write_checksum: sha1:7e75867184c7835316e3dba6c41f99915d8f66fe
+    pristine_git_object: 3b882c36e525b3f547b77796a644d7a533d3e275
+  docs/components/unifiedbenchmarksdaitemsource.md:
+    id: e45e347cc983
+    last_write_checksum: sha1:7d8c239a56a8fcabf6c8633fd174c88d21bd612c
+    pristine_git_object: 5690f32ab463b163e96353931423c22499ac17ab
+  docs/components/unifiedbenchmarksmeta.md:
+    id: eda2de5d8d6b
+    last_write_checksum: sha1:defd88dbce795b757a855c25953109f91791ea61
+    pristine_git_object: aced020dcc3fcc5c659bca9070063417ec3496d9
+  docs/components/unifiedbenchmarksmetasource.md:
+    id: 093d733c42fd
+    last_write_checksum: sha1:e820ca0846602261b47e18ccca1005042ded4024
+    pristine_git_object: bf52e964cd5ad79dde98693f436788f1e7c1a764
+  docs/components/unifiedbenchmarksmetaversion.md:
+    id: 883a12af05e5
+    last_write_checksum: sha1:df710f97d758bb6403da1438fd81221a03142e64
+    pristine_git_object: fa7abb7a34e41e9bba65d7e902d1bffbd431a7ba
+  docs/components/unifiedbenchmarksresponse.md:
+    id: 711086447b69
+    last_write_checksum: sha1:6278d07a5e342097572f380e22c0af1c88070a05
+    pristine_git_object: 1fa09b414027fbf850446167276ccc554f5446f0
+  docs/components/unifiedbenchmarksresponsedata.md:
+    id: df6d6262fae1
+    last_write_checksum: sha1:42427d4695c2a5c5c66233b358442cd62e55e2e0
+    pristine_git_object: 58d4d7d8c3b5943e09024f28b0444097ea6f8bbb
   docs/components/uniqueinsight.md:
     id: 8f721a7538ef
     last_write_checksum: sha1:d1955a3237b8047e074df6a6cf0e158beeac10c0
     pristine_git_object: 3395cb6ae241647ad498206ba1672bc3e4a1f7fc
+  docs/components/unit.md:
+    id: 0b0f1341f4ee
+    last_write_checksum: sha1:b9ff7dec614b495c5512b9228d018dda7d78fdc9
+    pristine_git_object: 42e2fb33a744ffbb03cbae27c94401c51f0d83c0
   docs/components/unprocessableentityresponseerrordata.md:
     id: 6a36f0c9d959
     last_write_checksum: sha1:b7adc7ae81b79cb1436c8f85b45283fe52320d81
@@ -4602,12 +4802,24 @@ trackedFiles:
     pristine_git_object: cf10c9e56352e1ef074e794b915639774a0de872
   docs/components/videogenerationrequest.md:
     id: cacead3ac9fe
-    last_write_checksum: sha1:c87d8d7a7ce900738b6a536f863a34cf36854506
-    pristine_git_object: 3a2a2df8edd75d87dade8b35c075759ff91a5415
+    last_write_checksum: sha1:5f2a97129c791a736378af0331c8800da3e555d0
+    pristine_git_object: 8306cca5a6a8740243cd1bc49409bfd4b8e58891
+  docs/components/videogenerationrequestaspectratio.md:
+    id: 8183ceeab79d
+    last_write_checksum: sha1:8aad3355b02e6578e57dc64355c6e51fcb44f763
+    pristine_git_object: 16659f24b21051064e5fc6addbda9ebe73650a01
+  docs/components/videogenerationrequestoptions.md:
+    id: 6d200b026e3d
+    last_write_checksum: sha1:3dc9398562b531a5278c523a7a49740269decc28
+    pristine_git_object: 16366a5e635d8b51ebcd81482afb01eb6893d1af
   docs/components/videogenerationrequestprovider.md:
     id: e2a64e74f555
-    last_write_checksum: sha1:e27ed0509f52bc14e831d19fe4205ed37f5f65a8
-    pristine_git_object: 28a704024a917c0aaff8c53f2a8c9e20c7ee52b4
+    last_write_checksum: sha1:f0461ead71e8c146e9ba4fcfd1cdf3383828f125
+    pristine_git_object: b7e2128738d513fcbcadf9ffaec2e655c4e26419
+  docs/components/videogenerationrequestresolution.md:
+    id: 96bb24160b25
+    last_write_checksum: sha1:c5180c8900165f2c87fe36de22f6d5e695371dfd
+    pristine_git_object: 1af61111d11241b9c536e60ed23ffdcf4a375d33
   docs/components/videogenerationresponse.md:
     id: adbbd66af4bd
     last_write_checksum: sha1:52c73fc2047792e3194f316e3182a96f8c7b85f2
@@ -4846,8 +5058,8 @@ trackedFiles:
     pristine_git_object: 69dd549ec7f5f885101d08dd502e25748183aebf
   docs/operations/arena.md:
     id: a9de99ef2b33
-    last_write_checksum: sha1:72964c86d5b8a31c3144454e0ca717b111a5c4f4
-    pristine_git_object: bb57edab7f915ebccc0af37e46c11b7b23f9dfd9
+    last_write_checksum: sha1:e512fec90170ea812bad81c221a6537e2ef92f15
+    pristine_git_object: 1714dac53f131a38cd5cb11e270e5500b0740280
   docs/operations/bulkaddworkspacemembersglobals.md:
     id: 6cff183f93a1
     last_write_checksum: sha1:39941ebc9a51b0189aed03680e2168e25b7c9692
@@ -4908,6 +5120,10 @@ trackedFiles:
     id: 01cceb61d42f
     last_write_checksum: sha1:7e1d73bd30584d55f4b116737c15d7c73cdf6a3a
     pristine_git_object: 522f4978a3c4e1d1c0d197b541fc57e745b7d4e7
+  docs/operations/costdetails.md:
+    id: 777b240173de
+    last_write_checksum: sha1:b2748fc0cf305791446f5f217947d82bd74a8350
+    pristine_git_object: 58a1aa8485130f8b49c633dfef0439b83a5f239c
   docs/operations/createaudiospeechglobals.md:
     id: c67d64f11ad7
     last_write_checksum: sha1:a0026b1caf2268dd4a79177fa2bb630eca1498b4
@@ -4982,8 +5198,8 @@ trackedFiles:
     pristine_git_object: 1ff75cb8fa59d2b7b756ea07e9f5849995b62435
   docs/operations/createembeddingsusage.md:
     id: 2dc99973f6c7
-    last_write_checksum: sha1:b01ba733f5d1369b21a54b9f3bfb0e4059504b6f
-    pristine_git_object: 007fb235eef4ebb9b3dda14352e9a252004de4c2
+    last_write_checksum: sha1:292de8b3a80697b56a961d2eb7f97d54dd29c4ae
+    pristine_git_object: 639fb7e305ff27786b6ea858b425e36aaaf20252
   docs/operations/createguardrailglobals.md:
     id: 34f5b2a17330
     last_write_checksum: sha1:a43fb357b9c08974befd14a79da7623e72bc3245
@@ -4992,6 +5208,18 @@ trackedFiles:
     id: 2d8932b329b3
     last_write_checksum: sha1:e03ea14af1abe30c5dc38323a824a91fa817bc2d
     pristine_git_object: 74958a262f7d16b3cd8166b0a80a832d44b3df03
+  docs/operations/createimagesglobals.md:
+    id: a5e3bc55fcda
+    last_write_checksum: sha1:46b4241b2368ab79160dd347eae68445df55d0cd
+    pristine_git_object: 5b67f3639d1cf0a543f9f9930d1cae61b423c4e0
+  docs/operations/createimagesrequest.md:
+    id: cdafaa0c3856
+    last_write_checksum: sha1:17f63228061ce2f31c6631edb2536255ffb129b9
+    pristine_git_object: 26a6d04520f3711a61a53f121c89e2f4cbd693cc
+  docs/operations/createimagesresponse.md:
+    id: 42e21d45bf02
+    last_write_checksum: sha1:1d13ca55ce05a64da61acdfe71d878d91df777f4
+    pristine_git_object: 58bc07e6d75f13d766e336b9f868a8486d52d187
   docs/operations/createkeysdata.md:
     id: 903a6d611ab2
     last_write_checksum: sha1:78eb64a7cc6deeb3959adeb0ca705826f5f47005
@@ -5272,22 +5500,14 @@ trackedFiles:
     id: f6276c91ff17
     last_write_checksum: sha1:9c80418c5384e63542ea16aa336c3bfe54c23b64
     pristine_git_object: f0d402fbc8b66cc075706e056fd152e41e141c3f
-  docs/operations/getbenchmarksartificialanalysisglobals.md:
-    id: fc980e69438e
-    last_write_checksum: sha1:4b7871db540cc8d255518b0fb51845738a2b7d09
-    pristine_git_object: 8925cb558b063d232a4eab418279d6fe69443023
-  docs/operations/getbenchmarksartificialanalysisrequest.md:
-    id: 998a53047e6f
-    last_write_checksum: sha1:c4e6ee2f48087e0198b49e16c286f7034b043034
-    pristine_git_object: bca988aaed6a6fee2fa08342305a1070c2d41c95
-  docs/operations/getbenchmarksdesignarenaglobals.md:
-    id: 4e2f927bea8b
-    last_write_checksum: sha1:76d2ff4919b87f05d3672f5b660033d2c9e689a2
-    pristine_git_object: d6c6cad08146378c7794aa8af56234a01cf0df71
-  docs/operations/getbenchmarksdesignarenarequest.md:
-    id: aea9fe0d448c
-    last_write_checksum: sha1:433d65b3a6d7fe0b3e4a824a8ca9f9a36593a6be
-    pristine_git_object: 73202a7094b97faf481947434a8253f72eb872b6
+  docs/operations/getbenchmarksglobals.md:
+    id: 18c553c31212
+    last_write_checksum: sha1:99f5c115ff5fd28f04cb80fe4dfa280f12c7c68b
+    pristine_git_object: 215e03e822bc8d9945711a5b08bdb1790617dd3b
+  docs/operations/getbenchmarksrequest.md:
+    id: 0a40a540bba0
+    last_write_checksum: sha1:8102900af82a582c56bb903d521fddf4bc7bea8e
+    pristine_git_object: 3bf4626faebe849aa85814be508bc820c74a0868
   docs/operations/getbyokkeyglobals.md:
     id: 82a8cd8db21c
     last_write_checksum: sha1:4490949622267f537def903fa3efe64142925739
@@ -5580,6 +5800,22 @@ trackedFiles:
     id: 0e85f301aa5c
     last_write_checksum: sha1:69b2d4440e668dc9e76ebad86d5f70227276a31c
     pristine_git_object: c2e3510e7d805915eb9f493ac6cb092ec1a9d9dc
+  docs/operations/listimagemodelendpointsglobals.md:
+    id: 24c447cf0391
+    last_write_checksum: sha1:bc2e0cbf57b211cb37f3d0ec5e22a4e4ad8de12f
+    pristine_git_object: 8ac861e3954206f311e935cb0f555c430bd48f65
+  docs/operations/listimagemodelendpointsrequest.md:
+    id: 4e63ace27269
+    last_write_checksum: sha1:d8362d4de0204a7ee118c106e6150a89bb28c039
+    pristine_git_object: 27647dcaee248f17d21e6f1d6658eab1a7bbbe1a
+  docs/operations/listimagemodelsglobals.md:
+    id: d44612742724
+    last_write_checksum: sha1:4016d7f2b457583473315913e4056de5c9b0bf3b
+    pristine_git_object: c3edbe39ee3c886c9a45d511442aa6f6a8cf4801
+  docs/operations/listimagemodelsrequest.md:
+    id: 3b796f3db657
+    last_write_checksum: sha1:9a49a00fc5847eca4f41a90b552ba1622982c1e7
+    pristine_git_object: 2732ff2195c83246c0cd67cf88f2c5e528354936
   docs/operations/listkeyassignmentsglobals.md:
     id: eb16fba53032
     last_write_checksum: sha1:823375a0dc84574748befda39821c790b469a6b4
@@ -5828,10 +6064,18 @@ trackedFiles:
     id: 354b29241c52
     last_write_checksum: sha1:baf6f1195eeabcb4742fec427127f2c33ffd9b3c
     pristine_git_object: c4ba8c79c6ba3021472583b922c3ef01c4115bf4
+  docs/operations/source.md:
+    id: 8d5b4a7ef752
+    last_write_checksum: sha1:7ecc37abdbb6b9ac5e6bc3bac1254d4b5b4a6f2a
+    pristine_git_object: 244d7c7eae58985137b5615d4b4a0a9c552f1a00
   docs/operations/subcategory.md:
     id: "169243175101"
     last_write_checksum: sha1:ddf3195ab7768df3095efa4cc86ea7b5ca3504f3
     pristine_git_object: 912cc5d754a041cfdddbad5c704505a3f7da1cec
+  docs/operations/tasktype.md:
+    id: f741399fcc2a
+    last_write_checksum: sha1:e3b9c5b4a2b103ee4c7f60e7c8eb25b8a351c970
+    pristine_git_object: f978421391efaf8d7b0b449cbcba9b82a93d182a
   docs/operations/timerange.md:
     id: a5ee8c05a917
     last_write_checksum: sha1:00b61805899422b836494a24088ec33674316714
@@ -5948,6 +6192,10 @@ trackedFiles:
     id: e2bd25998427
     last_write_checksum: sha1:82bec11fedf21eed760739e1adb08fec06239279
     pristine_git_object: 6e72f51df9e9811cee424032f7dba0887e15afec
+  docs/sdks/benchmarks/README.md:
+    id: 61c16262af9b
+    last_write_checksum: sha1:e3030fe550fa8bb1d3379692f9633b5f8e98be99
+    pristine_git_object: 7a4db0f13ee00f246b5f13887a023fc70a3b74df
   docs/sdks/betaanalytics/README.md:
     id: e037af84b386
     last_write_checksum: sha1:78a1ed27ae55ac9b6e6926e2587adeda0de65aa3
@@ -5966,8 +6214,8 @@ trackedFiles:
     pristine_git_object: 1837ff59343eb87482e8750c1fb5d2b5f89aae6a
   docs/sdks/datasets/README.md:
     id: deb5d90f4faf
-    last_write_checksum: sha1:a3585d8d399421584c3f65610c59fe5dfbf897ab
-    pristine_git_object: f097289cff8c229c70c4f9e3e934f28372f69167
+    last_write_checksum: sha1:c09c0c118def84591a90132f77b67f40ae9e3d1e
+    pristine_git_object: afcf796dfd4d793bbfe7bcd3bdd81e5fe908de94
   docs/sdks/embeddings/README.md:
     id: 15b5b04486c1
     last_write_checksum: sha1:c2ed15521af31873f56e7813292aa30c5adf94e4
@@ -5988,6 +6236,10 @@ trackedFiles:
     id: f72b38a5a2a7
     last_write_checksum: sha1:e90c6c713afcfa087edfcb6367397b9109ac3af9
     pristine_git_object: 427dac57b47fbb136a16eb1ab7732c1ff61d7c2e
+  docs/sdks/images/README.md:
+    id: cc752c3524d0
+    last_write_checksum: sha1:5a7a17ae16ed1070ff54f29bf479699454c91f00
+    pristine_git_object: 65f916be2b82bb2a8f62757aa39b95c6f226dbd1
   docs/sdks/models/README.md:
     id: b35bdf4bc7ed
     last_write_checksum: sha1:76c1efecbc8a679a233ea1a80bdb01ead5b65ce1
@@ -6006,8 +6258,8 @@ trackedFiles:
     pristine_git_object: 867781001d3d7c6e755bcd3024268d831d154732
   docs/sdks/presets/README.md:
     id: ead9668ae1dd
-    last_write_checksum: sha1:340a33451b0f832a07ed068df7ce71707e80484d
-    pristine_git_object: f31181e6253ccc15aaf6edf21fb489e49a0ec9ce
+    last_write_checksum: sha1:0aa9fa8fdbb965427f180d5087c574da43a33017
+    pristine_git_object: 7634cf25a4ec5a279c95c87d9073f824da285f19
   docs/sdks/providers/README.md:
     id: b02aa45c0093
     last_write_checksum: sha1:576c938477d66de01f39db88b50caea41a6812d3
@@ -6018,8 +6270,8 @@ trackedFiles:
     pristine_git_object: a558abc06eb1e3251ae6a7993245f8e6e0ef3b2a
   docs/sdks/responses/README.md:
     id: e717bad14f63
-    last_write_checksum: sha1:5aacb6cdf4577af559b61207fba01dcc4dd9fdc8
-    pristine_git_object: b1c9d9fe27407f44f07c074db989fd4201dceaef
+    last_write_checksum: sha1:2fa7c76ae6c364248526d04871db0c16291bf60e
+    pristine_git_object: c9601f17bbd48441521f947aa7e312d2689f6b0b
   docs/sdks/stt/README.md:
     id: 0806154492f9
     last_write_checksum: sha1:a8b75526dac340b813f687081fab11165dec3d11
@@ -6030,8 +6282,8 @@ trackedFiles:
     pristine_git_object: 1543931c82477df894cca5b2a2e32838bc66bf5d
   docs/sdks/videogeneration/README.md:
     id: b6dbf7b0729c
-    last_write_checksum: sha1:caee1abd23bfb62bc9cb2e280efa51c98cfe38ef
-    pristine_git_object: ec02618703a38431fb34c15919848501ace2c91f
+    last_write_checksum: sha1:186dc73b0d741c97bb92c441ae7c99809e43449f
+    pristine_git_object: 393bdc66fbf85057da5811936439c48ad03a2322
   docs/sdks/workspaces/README.md:
     id: 1f5b051a6380
     last_write_checksum: sha1:e315405c5619ae4b47119d01951118cb658cba46
@@ -6042,8 +6294,8 @@ trackedFiles:
     pristine_git_object: 3e38f1a929f7d6b1d6de74604aa87e3d8f010544
   pyproject.toml:
     id: 5d07e7d72637
-    last_write_checksum: sha1:ccf5925a473a1eb527cec02639f862b79b601251
-    pristine_git_object: 396bd51f9c1428f03560f3e7988edc99edc698e8
+    last_write_checksum: sha1:8223abd8e7463dfa2b2c1097670bb28b2ec73e68
+    pristine_git_object: b98c0280ffbb42638747b1064375fa36f467223c
   scripts/prepare_readme.py:
     id: e0c5957a6035
     last_write_checksum: sha1:77f44b60b98bc126557ec27391f91dfba764bb54
@@ -6070,8 +6322,8 @@ trackedFiles:
     pristine_git_object: 07ace03229fd3267623c8f48665d2c3a67c3565d
   src/openrouter/_version.py:
     id: d8d15ad6c586
-    last_write_checksum: sha1:017dc1ec43588b31eee23532d74d4421993dd874
-    pristine_git_object: be619e3be1aa8d27deef5752ecc9ff09ccd4cd9f
+    last_write_checksum: sha1:856bdf17b7de36f6e1abd0b56f55bbc6093e4c68
+    pristine_git_object: ade61995259031f3789ff71f0cfd1d6ae4b39395
   src/openrouter/analytics.py:
     id: cb406b5aaabb
     last_write_checksum: sha1:6d47d1ab3da9cb4ac9f0a2bfe442f1a82a614f35
@@ -6084,6 +6336,10 @@ trackedFiles:
     id: c5733c5a1e12
     last_write_checksum: sha1:71f242fd9955e5a17a8d055e2210cc2708bb94fc
     pristine_git_object: fcffdcc6eaa61a4b79f7f1f76458eeb27e8f896d
+  src/openrouter/benchmarks.py:
+    id: 178d2ad8d706
+    last_write_checksum: sha1:1a4280d54c5db249e7089d03c304f57c51765b04
+    pristine_git_object: d29a685964300932a574e77d64558f7a34e97796
   src/openrouter/beta.py:
     id: fffdf54fd8f5
     last_write_checksum: sha1:7999d9294e23e166c6b27236262f1fb40139a4d1
@@ -6102,8 +6358,8 @@ trackedFiles:
     pristine_git_object: a1894915bd32aee65f019885634eb7908970a046
   src/openrouter/components/__init__.py:
     id: 81754e97b3f4
-    last_write_checksum: sha1:56e0c315ac8fe611bf70b465a91341acbbe34534
-    pristine_git_object: 2c07302c12f51cdf053e306906ac30862e925246
+    last_write_checksum: sha1:c78b26c54ae0c293e532cee699c4852dacbf93c8
+    pristine_git_object: a0f2bd7353f1a5d55fbab4c4a41b70b4265adfdf
   src/openrouter/components/aabenchmarkentry.py:
     id: e2e0f0b48c82
     last_write_checksum: sha1:1b6b66672fb80dccdc39843a98bdef6d7d804364
@@ -6122,8 +6378,8 @@ trackedFiles:
     pristine_git_object: e21d2d2322aad32dabda485132c4046d2ec6de89
   src/openrouter/components/advisorreasoning.py:
     id: d5af5c19fc73
-    last_write_checksum: sha1:ee69d03c9da3a6b9b42c3e6525d21d9c1910cfa1
-    pristine_git_object: 7376346542022324ca4d8475237e78346ee607dc
+    last_write_checksum: sha1:db9d67036b51e37b98ea76b383528af3d48f6ca6
+    pristine_git_object: a2ab43864d385b5554fc911cc9ee9ebe9893c10f
   src/openrouter/components/advisorservertool_openrouter.py:
     id: 4442cd9ad387
     last_write_checksum: sha1:c1825628e0bbba268e5addad89e7abe6e45b2926
@@ -6136,6 +6392,10 @@ trackedFiles:
     id: dc032c9ad744
     last_write_checksum: sha1:8e5d49d2b57114df7f4559b611d40769e65f9f78
     pristine_git_object: 597a5e01e843b06758f9c49b32d5d18d473dd106
+  src/openrouter/components/anthropicadvisormessageusageiteration.py:
+    id: 121ee5a5d831
+    last_write_checksum: sha1:dc0947f15ab23a783f4146c03b046351836300c7
+    pristine_git_object: 86b0175b497b07f6deb5f31edf994183c891d1e3
   src/openrouter/components/anthropicallowedcallers.py:
     id: b51c080db25a
     last_write_checksum: sha1:250ea2824392b7c385c4375a029a256f3d10afb4
@@ -6176,6 +6436,10 @@ trackedFiles:
     id: 1a120a6f2e0a
     last_write_checksum: sha1:997517abf99c9f97c4c76936f92a95f40eb0cf7f
     pristine_git_object: e64d16928a4efa5c07e431a317ec573963fe9310
+  src/openrouter/components/anthropiccompactionusageiteration.py:
+    id: fdfc1ef0420f
+    last_write_checksum: sha1:a30d2b6892509f226083dfd421f0b633ecc614da
+    pristine_git_object: 5b00555a9e606281c749d7d147ae58ca0868e396
   src/openrouter/components/anthropicdocumentblockparam.py:
     id: 2c3093530540
     last_write_checksum: sha1:db21d071f7ea9b0597a83da88697c1bc11d72981
@@ -6200,6 +6464,14 @@ trackedFiles:
     id: e48f71196f16
     last_write_checksum: sha1:92fb29d4e239e0cb361dde42a1e61a8486233a34
     pristine_git_object: 8ff4915a203908a5ae986f28357b7211590912d2
+  src/openrouter/components/anthropiciterationcachecreation.py:
+    id: d8eff6dbf240
+    last_write_checksum: sha1:54740194c3948b6066d700b47f54f9b42912ae15
+    pristine_git_object: 9447771803562a9dc7c9509c87c63ad65a914757
+  src/openrouter/components/anthropicmessageusageiteration.py:
+    id: d94b609d7d8e
+    last_write_checksum: sha1:64cce42227c30259261e6c0e9958a17e2afddbde
+    pristine_git_object: 0c76c28951383fc04cc9a95224811a0692d058fb
   src/openrouter/components/anthropicplaintextsource.py:
     id: ed38ef79c74b
     last_write_checksum: sha1:b6584da4f7255412f12de31e02c522fb84d4cfd0
@@ -6208,6 +6480,10 @@ trackedFiles:
     id: bccb7c6b3128
     last_write_checksum: sha1:2917cf9fe9a10f160359e7f43ecdcaf7bf172ebe
     pristine_git_object: f953ecdcfaf801ee1f89d23b3463642adbd85221
+  src/openrouter/components/anthropicspeed.py:
+    id: 7e39c29f3d89
+    last_write_checksum: sha1:19e37bf7ec082d89258f44674405811cc8a010ad
+    pristine_git_object: 4f9c2bc739541b12c381e3d6265184af879cc1ff
   src/openrouter/components/anthropictextblockparam.py:
     id: f387daeeb940
     last_write_checksum: sha1:315ad4fb2c0cede75e5b8dfe3d8dcd4842a03322
@@ -6228,6 +6504,10 @@ trackedFiles:
     id: f38744b90fdc
     last_write_checksum: sha1:6c367ebe08a45ad6f45ae9877e2852e917079c8e
     pristine_git_object: 97aca7f4209ba9ad038b97e35b9b8b8cd0e6e168
+  src/openrouter/components/anthropicunknownusageiteration.py:
+    id: e0c582be1ffd
+    last_write_checksum: sha1:7c50a515d361fdd0008f1c04a4babdcfe15c1b55
+    pristine_git_object: 5bbd2e0feacf932a927422a0ea9667493d9904cf
   src/openrouter/components/anthropicurlimagesource.py:
     id: 291b4d476bb8
     last_write_checksum: sha1:e6a8b32f053bfbe3debb8940b03135d1e8a00eb5
@@ -6236,6 +6516,10 @@ trackedFiles:
     id: 1f1d455d7db3
     last_write_checksum: sha1:37d89d625d5d7443993ac2c054b6cf37554eed15
     pristine_git_object: c0a140bcee011f2f86eb22eadc03281f8f59b894
+  src/openrouter/components/anthropicusageiteration.py:
+    id: 5e4d6928bcab
+    last_write_checksum: sha1:bdc2b877ec6d51b9480bd58fb4f2ae0308060ecb
+    pristine_git_object: a984e7a5e0de4d93e4a65582d97b8eb9c3b1a1ab
   src/openrouter/components/anthropicwebsearchresultblockparam.py:
     id: 7a85be31694c
     last_write_checksum: sha1:a87c04e8e05b3424f44a8ed55225b1bcb05b40b2
@@ -6340,34 +6624,10 @@ trackedFiles:
     id: 5533c01ab156
     last_write_checksum: sha1:0d74bf725e24809c704e0c293d72ea96a897446b
     pristine_git_object: 0e610680e018be53b3e62759ad61e9f7c416640b
-  src/openrouter/components/benchmarkpricing.py:
-    id: a7c56383dbe6
-    last_write_checksum: sha1:2af31e20dfde609e7d5c1b791e02b55a483d92c6
-    pristine_git_object: 3524f786e3f73c7436e061800ecd403d92854621
-  src/openrouter/components/benchmarksaaitem.py:
-    id: a90a5423d2ab
-    last_write_checksum: sha1:7b10783085a9bb672306573cf73a8a77f5d65973
-    pristine_git_object: 2855ffe10969511370a40e492b4956196a075864
-  src/openrouter/components/benchmarksaameta.py:
-    id: 67ea1de84da3
-    last_write_checksum: sha1:def05fd7d2546eeb56f2e908c1032aa2a9f8af1e
-    pristine_git_object: 9d751f4abb5b2d88625ecf05a447f9368b03999e
-  src/openrouter/components/benchmarksaaresponse.py:
-    id: b0b47f818fb0
-    last_write_checksum: sha1:9fff98aec7bdcf688bb46673949f2badf0c21c33
-    pristine_git_object: 787ae1ca313f84e1f958d01fbde16a7addfe30c3
-  src/openrouter/components/benchmarksdaitem.py:
-    id: 575945def054
-    last_write_checksum: sha1:7cd6079757b7be8f6e3add94eb05d68cf7c73bc4
-    pristine_git_object: 7713e2e8acdc2a75742873408b2238c163acba91
-  src/openrouter/components/benchmarksdameta.py:
-    id: dd1d01a44665
-    last_write_checksum: sha1:e8e640d403468fe3be115da58a843eb37cc2e292
-    pristine_git_object: 0ca3550d2febc93be4ef3f4df531ef4e2dca6358
-  src/openrouter/components/benchmarksdaresponse.py:
-    id: 9e8cefb8d1e1
-    last_write_checksum: sha1:694c9e050fec812c95cf37eeb53b9e3920773106
-    pristine_git_object: 7588fc5242eb12d83c24453d8dad455d6ee7e1aa
+  src/openrouter/components/booleancapability.py:
+    id: 6009fd660c03
+    last_write_checksum: sha1:2615f4f9eecdf753ece20adc9897553404c71cc1
+    pristine_git_object: 75d5ed893814b2af7bd59a0f4729ecbcd701bf6b
   src/openrouter/components/bulkaddworkspacemembersrequest.py:
     id: c042d4bce938
     last_write_checksum: sha1:dd5b69cce65985231a77351be04aadeecc85c46c
@@ -6424,6 +6684,10 @@ trackedFiles:
     id: 6738a8516caf
     last_write_checksum: sha1:6ccf194550ae1f9844b3f2ef38523abeee676cf1
     pristine_git_object: 1786f6d4d76b38ecfdbcc3281845b424119b8450
+  src/openrouter/components/capabilitydescriptor.py:
+    id: 368790a86f10
+    last_write_checksum: sha1:13a2fe668fd9d3fdb2d6941cf7a14b49f8168066
+    pristine_git_object: 3b40c65b1bd2d08a6d01c3ec69023bd64a72907d
   src/openrouter/components/chatassistantimages.py:
     id: 993f9dcd8575
     last_write_checksum: sha1:0b6be31bb9c8b3bc8f2098af5b2bd12b62a710bb
@@ -6522,8 +6786,8 @@ trackedFiles:
     pristine_git_object: 8bbde153b53887e426989fd5b0486b6dc1122810
   src/openrouter/components/chatrequest.py:
     id: 5e39eaefa9cf
-    last_write_checksum: sha1:65012c617dd06019eb4bf62d04c434ebfb23adcc
-    pristine_git_object: f90c290577966b6fc85afaf1634b2413b02661b6
+    last_write_checksum: sha1:eb9f865918863ceb12508060f3bc8605f3a9a87a
+    pristine_git_object: f60f367c641cb92d48bbc2873bba0704800165d9
   src/openrouter/components/chatresult.py:
     id: 9062fe2935fe
     last_write_checksum: sha1:b44dc25412b1206cc188d9516191a273d0f3e4dc
@@ -6542,8 +6806,8 @@ trackedFiles:
     pristine_git_object: 9166d93e4c351c7465ba67e2e7f4708038d6ef2b
   src/openrouter/components/chatstreamchunk.py:
     id: 16cdd8d4a3d1
-    last_write_checksum: sha1:fe5022e99730741f13a46946596fe8221c9ae8e8
-    pristine_git_object: 52c37761f777435f6d75e03242f8b9069f08a84f
+    last_write_checksum: sha1:bd2845becfca81aeeffebf56a5e986bd3a0504b0
+    pristine_git_object: 33d4daba19f61ddc7bf93877892347d99d15a910
   src/openrouter/components/chatstreamdelta.py:
     id: 7484252729d4
     last_write_checksum: sha1:2e1a6408c51e6519337e01c394f4ce7695edf573
@@ -6586,8 +6850,8 @@ trackedFiles:
     pristine_git_object: 2ccba8386486b7a730816a9829b01754935a2e96
   src/openrouter/components/chatusage.py:
     id: f224a054bf45
-    last_write_checksum: sha1:947079d2163225a49e423151de25dc6132df5bf6
-    pristine_git_object: 3a7357d8a6f725ba18b1f15215a197f11e917659
+    last_write_checksum: sha1:b97beddfd0229cf3d993948cbad3bd45ca76d7fc
+    pristine_git_object: 8eb123a284d3fe9604c0f97ec225da377b0fbd88
   src/openrouter/components/chatusermessage.py:
     id: 7777191e729a
     last_write_checksum: sha1:1ecc9101c05178427d73e455de4d679ac8d78015
@@ -6764,6 +7028,10 @@ trackedFiles:
     id: 96ac233137bf
     last_write_checksum: sha1:0e20ce9fd09b64922e63b1bf37395bb80ea3e440
     pristine_git_object: 3eaaa33c3856a99254c617bcfe98693f31db1234
+  src/openrouter/components/debugevent.py:
+    id: 5ecad6212326
+    last_write_checksum: sha1:437a5547042617c66b1e59e25388d77729dd28c4
+    pristine_git_object: e163680e5e5e254a73a0646e4b562cd0b46065d0
   src/openrouter/components/defaultparameters.py:
     id: 548f4f885c22
     last_write_checksum: sha1:ed72fc048f61ec663361ab2206cd140c35971a0e
@@ -6808,6 +7076,10 @@ trackedFiles:
     id: e935c578fce8
     last_write_checksum: sha1:8a9c8184852faf1e3ca9a478e48df41ccac6fc33
     pristine_git_object: ed5f8af0c599b1e55bb1939bc1d2aff0aeef610d
+  src/openrouter/components/enumcapability.py:
+    id: 1eddd72a17a5
+    last_write_checksum: sha1:09e366c414f84edb166eeb8e9091e278c15136d6
+    pristine_git_object: 468dba815ec1bb9a06cbf8983c8f13f2c585db59
   src/openrouter/components/errorevent.py:
     id: 8e87043bec43
     last_write_checksum: sha1:ca2fd0001394a54cbaaf07abb827184f58e1de9e
@@ -6930,8 +7202,8 @@ trackedFiles:
     pristine_git_object: 5729ea0c31a0ce7283a77316282ea77c91f13ae3
   src/openrouter/components/fusionservertoolconfig.py:
     id: 0d1d229c531f
-    last_write_checksum: sha1:9f013aa6431316312a04ad960d3ef26d0a341356
-    pristine_git_object: 4eae6cf00e69b060b3a99ef75ccc7a3762de37d0
+    last_write_checksum: sha1:0aaf2b744bbade347bf6e14a68fa7d1351ea6236
+    pristine_git_object: a9631f6d4047651498a05e7171290408a098d21d
   src/openrouter/components/generationcontentdata.py:
     id: 0140215b5b46
     last_write_checksum: sha1:09e15ae2acc4f44084e2206ea51e6a06f4c5ee11
@@ -6980,6 +7252,10 @@ trackedFiles:
     id: 674f6eca2929
     last_write_checksum: sha1:8eaffb70806c74b1111b377b0024375f3c80ef44
     pristine_git_object: d24d5e2bf337e19bb80a1aa24b8b27c93d67f1b1
+  src/openrouter/components/imageendpoint.py:
+    id: 6466b0bedef0
+    last_write_checksum: sha1:b619627cc7e24b774b1786f763b2d5c8db766e1d
+    pristine_git_object: 8d392046999ddf1f251215f892b6bb3371ed1e9a
   src/openrouter/components/imagegencallcompletedevent.py:
     id: cbf654faeb3e
     last_write_checksum: sha1:8fb3e34408dd8b167afc6aad641de9cc2483c9f1
@@ -6996,10 +7272,22 @@ trackedFiles:
     id: 8d83770569d5
     last_write_checksum: sha1:c56b462d54b40d74e37bda390528b127565b33fd
     pristine_git_object: 5f17d77c25a82ad2bf7b1211d05ee665b6fee35a
+  src/openrouter/components/imagegencompletedevent.py:
+    id: 7a791a02cb5b
+    last_write_checksum: sha1:2e5822401bac22b5936ed4787b3d648eed60e725
+    pristine_git_object: e5907de80032821f54ab0829729f137497b6f289
+  src/openrouter/components/imagegenerationrequest.py:
+    id: f8291a7be9a0
+    last_write_checksum: sha1:370aff39ae6c2cd8913b94d23ff8e1941747ec76
+    pristine_git_object: 2a4b849a68aaa8a81fba188f1bf52e5387e65fe3
+  src/openrouter/components/imagegenerationresponse.py:
+    id: 53354cd0cbfc
+    last_write_checksum: sha1:e1c531b4a761668151800f450b82dfab0da00f77
+    pristine_git_object: deb67493a8ace61abf039d5d6d46b33e37a7c66c
   src/openrouter/components/imagegenerationservertool.py:
     id: 9c95bc975f2e
-    last_write_checksum: sha1:5b6cf7e4c433056713467e1fbb680e644a1f47bc
-    pristine_git_object: 1bb3764815a286c4774d5b0a6b841c1606d57fa0
+    last_write_checksum: sha1:b7e0d9db78b0b7662cd34a31e593842cea5ef990
+    pristine_git_object: dfcb122b1ce68cc165b0b86b603b658670320eff
   src/openrouter/components/imagegenerationservertool_openrouter.py:
     id: b7499cf15b3a
     last_write_checksum: sha1:2a253a105b37e5e1b6b3b9345cdaf64ebe65f703
@@ -7016,6 +7304,46 @@ trackedFiles:
     id: f257690edb46
     last_write_checksum: sha1:8ae33e94dc42144f3269a65834ed7d59aeab3c69
     pristine_git_object: eb59bfd0d4b89dde72504f8aa57533c689474ced
+  src/openrouter/components/imagegenerationusage.py:
+    id: f51151e8dbfa
+    last_write_checksum: sha1:94b36c85779166c24486c3f8cb59dd5b5e96f227
+    pristine_git_object: ddc1c84536c4579a40f3c58482dc0ad3dc74b5bc
+  src/openrouter/components/imagegenpartialimageevent.py:
+    id: f88cea0c67fc
+    last_write_checksum: sha1:2ee76cbb50b60ebe624bdfe0769a7bbdce047cd0
+    pristine_git_object: ad454de88a0dd65f464fb25a982d3c4060d17994
+  src/openrouter/components/imagegenstreamerrorevent.py:
+    id: 15c890eb8a08
+    last_write_checksum: sha1:3472a96f7a2855a043011f43d5a72eb51ebd5458
+    pristine_git_object: 9396413a957395a3fb784b80a443f12cf35948cf
+  src/openrouter/components/imagemodelarchitecture.py:
+    id: 5f3e50733fe9
+    last_write_checksum: sha1:207defb8e73dde6e8f0f431ddd1c26c00671cd8b
+    pristine_git_object: 5e93aaa1401ef96452bda0ff80d520b190968d86
+  src/openrouter/components/imagemodelendpointsresponse.py:
+    id: f3d538d38ec2
+    last_write_checksum: sha1:e10cae58b2bb98ab1a0df6fc162f402ac1561d3c
+    pristine_git_object: d97d1ee622f150b70dbaeda2db870711c97c1e4d
+  src/openrouter/components/imagemodellistitem.py:
+    id: 0e8365caa96c
+    last_write_checksum: sha1:28308827116fa3810cbd776bed12d0a300848ed6
+    pristine_git_object: f2bb3e2929198956accdf1e98fc8c947838b2399
+  src/openrouter/components/imagemodelslistresponse.py:
+    id: 9616976ca854
+    last_write_checksum: sha1:22cfac5912511e7cfbf4a60dc5e2bb835f5a11bd
+    pristine_git_object: d36ed6324c9a9a973b1564fc08dcd7e30e9db25a
+  src/openrouter/components/imageoutputmodality.py:
+    id: 56bf82622455
+    last_write_checksum: sha1:fdd714b24893d1cc9a488a8927f6659188427438
+    pristine_git_object: 9c5a7a430aa6103cc10052b1d6c278181071180c
+  src/openrouter/components/imagepricingentry.py:
+    id: 58bd958fe130
+    last_write_checksum: sha1:62645aeb8bd8ea04844616e6f21e7c863585a2fd
+    pristine_git_object: 8a8700461f2731e8ca7e1b62d6c41d5afc24d015
+  src/openrouter/components/imagestreamingresponse.py:
+    id: 7de5604ae99c
+    last_write_checksum: sha1:5ac700ab9ab34476b5831d438747e2ca89d0b9c5
+    pristine_git_object: 74c8f0665e48d0442fd6c67e86bce01b3c948c6e
   src/openrouter/components/incompletedetails.py:
     id: 1984e5246b23
     last_write_checksum: sha1:494eaf7185deb1ef3b12d4e81711a8aec012445f
@@ -7178,8 +7506,8 @@ trackedFiles:
     pristine_git_object: 1257b38d2001f34078cd1b052c20264e81a95e57
   src/openrouter/components/model.py:
     id: cef3adaa772b
-    last_write_checksum: sha1:53eb4a044a7bf546225416bb08597df46a3b60a2
-    pristine_git_object: 637b3fbe54ddcc454750d8de702045ee690c3333
+    last_write_checksum: sha1:53f544fe39ae08cde33f99c5d0bb4b6cc1555301
+    pristine_git_object: c0345109fb1717ea27010605984c27e1137426fd
   src/openrouter/components/modelarchitecture.py:
     id: b37ac27e512b
     last_write_checksum: sha1:e1dd41aa140b2ca2c3bbf15abf74e034d42b0166
@@ -7196,6 +7524,10 @@ trackedFiles:
     id: b8759a1a4787
     last_write_checksum: sha1:69b2c991666848f4790e5136c67553733cc68a54
     pristine_git_object: c197cb2c527296adff2c3cfd9e49bcbc48087ce7
+  src/openrouter/components/modelreasoning.py:
+    id: 58bb3f2d75e0
+    last_write_checksum: sha1:d7decd330533b566bda99e6b4b5e120970cf61f1
+    pristine_git_object: fa73b90a1b4b140d6b9ceb9ac284142c4d95e4d7
   src/openrouter/components/modelresponse.py:
     id: 023136e6dedf
     last_write_checksum: sha1:af84587984cbe6341f59f176b08df43096ac48c6
@@ -7222,8 +7554,8 @@ trackedFiles:
     pristine_git_object: 5b8ca0ce252ca2fc909770c5c338793b05877a91
   src/openrouter/components/observabilityarizedestination.py:
     id: 8926882c1d18
-    last_write_checksum: sha1:85184a10e7e8e135038392296e6e4bf6695a66e9
-    pristine_git_object: 142a548baf77b7e25fb0088cabb3a94fcc2bf34f
+    last_write_checksum: sha1:d9dfd8b65cbb889188c000cf4dfee81f18a0e1ba
+    pristine_git_object: fdcc98dd16e3e38d4e3d2bea91139ee62ac41570
   src/openrouter/components/observabilitybraintrustdestination.py:
     id: 432de20d1c77
     last_write_checksum: sha1:1ba768fc9387674e430704553c6f8e202f3396ac
@@ -7620,6 +7952,10 @@ trackedFiles:
     id: bde317b3d703
     last_write_checksum: sha1:96b042899bfb818f20d282be76ad37fc948a599d
     pristine_git_object: dfcecafdc6d2a3a3dbc7beec2f07e1258415b2b4
+  src/openrouter/components/rangecapability.py:
+    id: ac3aad570488
+    last_write_checksum: sha1:9eaed841f5e178925a070ebcbe6f18b4178dbaab
+    pristine_git_object: 76fabc08d96646862e7a1618d39d84934a25b5e4
   src/openrouter/components/rankingsdailyitem.py:
     id: 9aab72b1d643
     last_write_checksum: sha1:c753fd7363f424f144710ceb18456f882d7b6e6e
@@ -7662,8 +7998,8 @@ trackedFiles:
     pristine_git_object: 29c0fc9a1ff14d26fc99a70bac491ce3b4240384
   src/openrouter/components/reasoningeffort.py:
     id: cadb8da93572
-    last_write_checksum: sha1:a4d9c3c61ccfc2842592ca33d310b15b60bf9a10
-    pristine_git_object: 3cf5b2e32d9b73277c73db6141e841f416fba384
+    last_write_checksum: sha1:f0cac6530b869890e30631e9d42eedae0f2a5be8
+    pristine_git_object: fe3562c76fc28d2f8cacd49a12c0a0500b069147
   src/openrouter/components/reasoningformat.py:
     id: 99d79e5500b6
     last_write_checksum: sha1:bfb111196309079ff8dcb09ab406d08a3a809e67
@@ -7730,8 +8066,8 @@ trackedFiles:
     pristine_git_object: d3c77624292ba0985104a6125e462c305a633d84
   src/openrouter/components/responsesrequest.py:
     id: 8c850080ec5d
-    last_write_checksum: sha1:f3943c6484819e73eafb9baaa6ee56bfe2fb0ae7
-    pristine_git_object: 8f4b2a3e17f49d7059cd5427e65d76a41f3a380b
+    last_write_checksum: sha1:20d13187b1c6e2530e2bcdaa7c3f551e99065121
+    pristine_git_object: 683fab4a6f2fba854b0d920a787307f4977e94a1
   src/openrouter/components/responsesstreamingresponse.py:
     id: 142379f3bd90
     last_write_checksum: sha1:a48d6f3610f5d15248ef4d25a0d88a0a4a1a9db7
@@ -7834,8 +8170,8 @@ trackedFiles:
     pristine_git_object: ffb7a43e64bfef2809683fe60a5d17744ea345c3
   src/openrouter/components/streamevents.py:
     id: 331636234c76
-    last_write_checksum: sha1:482d71c2b91da416ea0754f4cfc613465160208c
-    pristine_git_object: b1e1e147f0333345f7a25fecebb41b31e51127f6
+    last_write_checksum: sha1:cddb5b06cdaf9ad42dbb49ffa918b8cd19b36749
+    pristine_git_object: 0761a9610b5a27a071785b4e8d849410aaf64623
   src/openrouter/components/streameventsresponsecompleted.py:
     id: fd244f61371c
     last_write_checksum: sha1:011e0930c7994f64dbee78c0a4c2fa5d7167d8ab
@@ -7886,8 +8222,8 @@ trackedFiles:
     pristine_git_object: 8e1417b1cf116bf26060143dcab214d2623bddcf
   src/openrouter/components/subagentreasoning.py:
     id: 2715ebf26eb3
-    last_write_checksum: sha1:40e3041f4cf9ac8b4371e6351686cbf537d17da1
-    pristine_git_object: 1eb4e862985164f2e48b53dd0119d42bf8bed25e
+    last_write_checksum: sha1:ce0a8989c3e42612edf46770a0039aca05b949de
+    pristine_git_object: d2d508152e2a4339602d010776894f76210b3abf
   src/openrouter/components/subagentservertool_openrouter.py:
     id: f08524c6985a
     last_write_checksum: sha1:771b71aae9989727ea3564615f06da7f08431705
@@ -7936,6 +8272,26 @@ trackedFiles:
     id: 7d9755fc8395
     last_write_checksum: sha1:d614e72cc67bf6c4da7f57cf0f4367de726ec06d
     pristine_git_object: 0fc3c7c3991891ae00ae2f624df78d21e0ae05a8
+  src/openrouter/components/unifiedbenchmarkpricing.py:
+    id: b08adf1a31d0
+    last_write_checksum: sha1:e8d1cb425c61a7094f50a73e59cec6d64dc34204
+    pristine_git_object: bad387cea54fcab00e8a7fe54780dd97a29d72c3
+  src/openrouter/components/unifiedbenchmarksaaitem.py:
+    id: cc8382ac1af5
+    last_write_checksum: sha1:39fc6f0409234ec30e6bbdba2736e278abda8756
+    pristine_git_object: a01518d4c996f16bd740489684b20a9682db0f0e
+  src/openrouter/components/unifiedbenchmarksdaitem.py:
+    id: 946501943ce2
+    last_write_checksum: sha1:22bbe61dd833db3da96796ebfdcd3141dd0ed126
+    pristine_git_object: 0bb8159d555e263bd875bd42e1cf0e552c3573b5
+  src/openrouter/components/unifiedbenchmarksmeta.py:
+    id: ca02b44f633a
+    last_write_checksum: sha1:fdf3983fad9a3c119c88a1fe5e3d314787dcf248
+    pristine_git_object: 6106104d5249ae04075f1905f330b5aeaaaeb02c
+  src/openrouter/components/unifiedbenchmarksresponse.py:
+    id: 4f7bbccaba03
+    last_write_checksum: sha1:f0775bb4427be9ad7c01942e5048a103647a78eb
+    pristine_git_object: 8f064226057a3d4d331cee102713813a208452cc
   src/openrouter/components/unprocessableentityresponseerrordata.py:
     id: e8ca4a51f994
     last_write_checksum: sha1:d9ff0dea491e12d5ccb28607eb65f00fe8d694aa
@@ -7990,8 +8346,8 @@ trackedFiles:
     pristine_git_object: b140a02148be319bb2aeb0287bdd6e031ad6a3a4
   src/openrouter/components/videogenerationrequest.py:
     id: 70e3c9ff288c
-    last_write_checksum: sha1:b933805b55daa65d78997fe85a11e18e56aa924a
-    pristine_git_object: ae3bd049ac980f82a4b0b501e24b4f1fd8238bc4
+    last_write_checksum: sha1:69de9896aeb142ed305e7ee7dad73d6a270a9696
+    pristine_git_object: b755afef353e017b282326ef137f171d1bb34779
   src/openrouter/components/videogenerationresponse.py:
     id: 541f1321b072
     last_write_checksum: sha1:051ace67776106616ec4c8e55cf2df9a99855d0f
@@ -8106,8 +8462,8 @@ trackedFiles:
     pristine_git_object: 0a376fb8ee2df0be8546458e0008a2fbc0fd492a
   src/openrouter/datasets.py:
     id: 2378f80d1d6a
-    last_write_checksum: sha1:16857b6d0c5e815cfacb6db6eef804dd37493a38
-    pristine_git_object: c80a941f2da9bc4c71561fb804ca4e64dfb7c31b
+    last_write_checksum: sha1:057b0dde4e051f2cf5cd9fd5b82bbe45eb8fafc5
+    pristine_git_object: c483912549b3243f73b300bcea343914e66ef211
   src/openrouter/embeddings.py:
     id: 0374ace39067
     last_write_checksum: sha1:8622e7717ef639f2ee452d295c4b2c957a2fe13f
@@ -8212,6 +8568,10 @@ trackedFiles:
     id: e9311185443d
     last_write_checksum: sha1:5e55338d6ee9f01ab648cad4380201a8a3da7dd7
     pristine_git_object: 89560b566073785535643e694c112bedbd3db13d
+  src/openrouter/images.py:
+    id: c4d7adf63ae0
+    last_write_checksum: sha1:1bfa3a9cf3bd0eb942d50d77e96bfe456ee9e688
+    pristine_git_object: 87b2682c7449ab1be4f24ed44143769772e51b72
   src/openrouter/models/__init__.py:
     id: ed73b93abb3f
     last_write_checksum: sha1:fd931d5c2d58b5f9189cc897e038d6d78e362dab
@@ -8238,8 +8598,8 @@ trackedFiles:
     pristine_git_object: 37ee42a638f5fce69fc7db1e6b86efb51f381582
   src/openrouter/operations/__init__.py:
     id: 9afcea1e7161
-    last_write_checksum: sha1:5b56b8c29c9360d44a121cdb78811b323c2f5093
-    pristine_git_object: 8b12f08941bfd82eabf06beb651eaced69f48158
+    last_write_checksum: sha1:37c5b5e2b3a61573352877b05522e1ebb89ce973
+    pristine_git_object: 1159429afa31b7b071d0fff39ab291963e471eb6
   src/openrouter/operations/bulkaddworkspacemembers.py:
     id: e0ed56117619
     last_write_checksum: sha1:2b9c73dd8a24d6c479d50118a309e4e0969ca7ea
@@ -8282,12 +8642,16 @@ trackedFiles:
     pristine_git_object: 523d24efa869d63a145167b94e811671b84c5cfb
   src/openrouter/operations/createembeddings.py:
     id: fe1160a960e9
-    last_write_checksum: sha1:5307ac65b8a4c3eec3de9158c2a3d10554212e8b
-    pristine_git_object: 4cc4c5c044fa87a8ae21dd7aa0f83d09f4d00f09
+    last_write_checksum: sha1:55a231d6e9a2f2a76c3fbc1f8af893e393e08bc3
+    pristine_git_object: 6459cab7e1a597f5a1b24f690d845b4ee8809236
   src/openrouter/operations/createguardrail.py:
     id: 52ed4b2f5903
     last_write_checksum: sha1:119141c01d19df6b6d090b67f80145e3bf4d4d60
     pristine_git_object: 75b9661b38be99f2a067eda4051592111301bed1
+  src/openrouter/operations/createimages.py:
+    id: ef9b8b32ed45
+    last_write_checksum: sha1:d88655f88d52b99844fd4bdd2a07554543f3ce65
+    pristine_git_object: dcc89c263d4ade2a6cee42a3d42c343546cf313f
   src/openrouter/operations/createkeys.py:
     id: 64ad31fdaa6c
     last_write_checksum: sha1:41931fecbca34b228d5fe6230810eb6bf9271250
@@ -8368,14 +8732,10 @@ trackedFiles:
     id: 5ffd23dafcc1
     last_write_checksum: sha1:c9011252cc7862d8c35b4ff2f3c82003c98953de
     pristine_git_object: d19ef64ed4dcc19027c95ba19c9b37ed301ebb72
-  src/openrouter/operations/getbenchmarksartificialanalysis.py:
-    id: c967fd553338
-    last_write_checksum: sha1:75aed29dbc8f9d41ba0eb3dabd077a2747018eb9
-    pristine_git_object: 707ed91247e14983a8fdc1241b83c9512db9144f
-  src/openrouter/operations/getbenchmarksdesignarena.py:
-    id: b05492401be4
-    last_write_checksum: sha1:fa36e7a28e19c67d8b72060ce85fa6c83e3b7ca9
-    pristine_git_object: 2ac2aed2e814ba1a8dc6ad49d05ae582a42f149d
+  src/openrouter/operations/getbenchmarks.py:
+    id: 5fb88644491e
+    last_write_checksum: sha1:03d0020dcfe87f6f0d8e9a36f6374ec4bba3f8eb
+    pristine_git_object: 480c2f31a1714ecdc1e83b34fb2a1fca0be5aa99
   src/openrouter/operations/getbyokkey.py:
     id: d141452bd88a
     last_write_checksum: sha1:16c33afc84cd0d3a68e977e739a59d14dfd3bd44
@@ -8480,6 +8840,14 @@ trackedFiles:
     id: c99a9e7be93c
     last_write_checksum: sha1:f82932a120516264880ec2defa377bb03a56071f
     pristine_git_object: f91db9e67fe3a10b2fffd681a517a65eee4df8c8
+  src/openrouter/operations/listimagemodelendpoints.py:
+    id: 40fd868ead3f
+    last_write_checksum: sha1:a59e2ecd4a27fe12141b7dd34befcae00c1d6206
+    pristine_git_object: 15c606cc2a3a7a5c6825124c9ea09c7f9a9c31ad
+  src/openrouter/operations/listimagemodels.py:
+    id: ad2131e4aa6c
+    last_write_checksum: sha1:aefb1c9ab70ad8d1e53e2bd636807c12f4c5744c
+    pristine_git_object: e5c89ce75ede0c49f529ffced4a041b1d05d48f0
   src/openrouter/operations/listkeyassignments.py:
     id: e26c11d1bd3c
     last_write_checksum: sha1:2c4e9b2dac5566beb3b4f1331686ec45c174e021
@@ -8574,8 +8942,8 @@ trackedFiles:
     pristine_git_object: ad2e7f86b6138cf2b2137345155e2b3a5784fb46
   src/openrouter/presets.py:
     id: bd0c40379dcd
-    last_write_checksum: sha1:e8ce79b2a8f66c69a5b4ae926cc57d7751044f3b
-    pristine_git_object: ae12a80da2520719fd06717796b8b8cc4a7d9354
+    last_write_checksum: sha1:111213da287ffa31236e542bbd089a536b29cf04
+    pristine_git_object: 0272fbeeae46c7e60091ad39db30ac8c24dd114e
   src/openrouter/providers.py:
     id: debc4c48f149
     last_write_checksum: sha1:f39f155f26e6f5e4fb5b7e0f577a8c49536f6bb3
@@ -8590,12 +8958,12 @@ trackedFiles:
     pristine_git_object: 96401a2fe86fefe574e073952ca235e71953fbec
   src/openrouter/responses.py:
     id: f2108fb635e1
-    last_write_checksum: sha1:e21e99418d831ca2f606406cc2736b39ecf02bd0
-    pristine_git_object: 944aff9aa812fff9b702d8735a37ea279d915a1d
+    last_write_checksum: sha1:2d50009bcadc43406cab3a16fb72feca6c54ec82
+    pristine_git_object: e80404c46cf9516ca4ad7bdb1760a810d5a3850e
   src/openrouter/sdk.py:
     id: ee9846c4c9c5
-    last_write_checksum: sha1:b2d1f64ba5783c98dc31e15e23966d83abaa2d9d
-    pristine_git_object: abc46c8355ba5cd0fee2e8e1536ac90eda7aa1b4
+    last_write_checksum: sha1:d4481423bac4d3b0db812ea1097184dd7da6d1ff
+    pristine_git_object: 729932c89d0c42946d66722e68100986eaa81ad9
   src/openrouter/sdkconfiguration.py:
     id: 55773bb98d7c
     last_write_checksum: sha1:c01826125c31a8b8bc99d9d679782c8758fae001
@@ -8686,8 +9054,8 @@ trackedFiles:
     pristine_git_object: dae01a44384ac3bc13ae07453a053bf6c898ebe3
   src/openrouter/video_generation.py:
     id: d0a90c1b8efe
-    last_write_checksum: sha1:1d2b872c5f939b1758603eede3584cce3d5a97f6
-    pristine_git_object: 30f265d1bebd524ab6db41e4529d64d8df561d44
+    last_write_checksum: sha1:d752e915a80df1f48a7ca35e901b50175fe3682b
+    pristine_git_object: cdd7182ff939a02a0bbcd135c06a3b34d50e7076
   src/openrouter/workspaces.py:
     id: cd6c533b1802
     last_write_checksum: sha1:2d9fc04510d5e28f57f23eacd7a5814495b127e7
@@ -10042,5 +10410,65 @@ examples:
           application/json: {"error": {"code": 404, "message": "Resource not found"}}
         "500":
           application/json: {"error": {"code": 500, "message": "Internal Server Error"}}
+  getBenchmarks:
+    speakeasy-default-get-benchmarks:
+      responses:
+        "200":
+          application/json: {"data": [{"agentic_index": 58.3, "coding_index": 65.8, "display_name": "GPT-4o", "intelligence_index": 71.2, "model_permaslug": "openai/gpt-4o", "pricing": {"completion": "0.00001", "prompt": "0.0000025"}, "source": "artificial-analysis"}], "meta": {"as_of": "2026-06-03T12:00:00Z", "citation": null, "model_count": 1, "source": null, "source_url": null, "task_type": null, "version": "v1"}}
+        "400":
+          application/json: {"error": {"code": 400, "message": "Invalid request parameters"}}
+        "401":
+          application/json: {"error": {"code": 401, "message": "Missing Authentication header"}}
+        "429":
+          application/json: {"error": {"code": 429, "message": "Rate limit exceeded"}}
+        "500":
+          application/json: {"error": {"code": 500, "message": "Internal Server Error"}}
+  createImages:
+    speakeasy-default-create-images:
+      requestBody:
+        application/json: {"model": "bytedance-seed/seedream-4.5", "prompt": "a red panda astronaut floating in space, studio lighting"}
+      responses:
+        "200":
+          application/json: {"created": 1748372400, "data": [{"b64_json": "<base64-encoded-image>"}]}
+        "400":
+          application/json: {"error": {"code": 400, "message": "Invalid request parameters"}}
+        "401":
+          application/json: {"error": {"code": 401, "message": "Missing Authentication header"}}
+        "402":
+          application/json: {"error": {"code": 402, "message": "Insufficient credits. Add more using https://openrouter.ai/credits"}}
+        "403":
+          application/json: {"error": {"code": 403, "message": "Only management keys can perform this operation"}}
+        "404":
+          application/json: {"error": {"code": 404, "message": "Resource not found"}}
+        "429":
+          application/json: {"error": {"code": 429, "message": "Rate limit exceeded"}}
+        "500":
+          application/json: {"error": {"code": 500, "message": "Internal Server Error"}}
+        "502":
+          application/json: {"error": {"code": 502, "message": "Provider returned error"}}
+        "524":
+          application/json: {"error": {"code": 524, "message": "Request timed out. Please try again later."}}
+        "529":
+          application/json: {"error": {"code": 529, "message": "Provider returned error"}}
+  listImageModels:
+    speakeasy-default-list-image-models:
+      responses:
+        "200":
+          application/json: {"data": [{"architecture": {"input_modalities": ["text"], "output_modalities": ["image"]}, "created": 1692901234, "description": "A text-to-image model.", "endpoints": "/api/v1/images/models/bytedance-seed/seedream-4.5/endpoints", "id": "bytedance-seed/seedream-4.5", "name": "Seedream 4.5", "supported_parameters": {"resolution": {"type": "enum", "values": ["1K", "2K", "4K"]}}, "supports_streaming": false}]}
+        "500":
+          application/json: {"error": {"code": 500, "message": "Internal Server Error"}}
+  listImageModelEndpoints:
+    speakeasy-default-list-image-model-endpoints:
+      parameters:
+        path:
+          author: "bytedance-seed"
+          slug: "seedream-4.5"
+      responses:
+        "200":
+          application/json: {"endpoints": [{"allowed_passthrough_parameters": [], "pricing": [{"billable": "output_image", "cost_usd": 0.05, "unit": "image"}], "provider_name": "Bytedance", "provider_slug": "bytedance", "provider_tag": "bytedance", "supported_parameters": {"resolution": {"type": "enum", "values": ["1K", "2K", "4K"]}}, "supports_streaming": false}], "id": "bytedance-seed/seedream-4.5"}
+        "404":
+          application/json: {"error": {"code": 404, "message": "Resource not found"}}
+        "500":
+          application/json: {"error": {"code": 500, "message": "Internal Server Error"}}
 examplesVersion: 1.0.2
-releaseNotes: "## Python SDK Changes:\n* `open_router.beta.responses.send()`: \n  *  `request` **Changed** **Breaking** :warning:\n  *  `response` **Changed** **Breaking** :warning:\n* `open_router.presets.create_presets_responses()`:  `request` **Changed** **Breaking** :warning:\n* `open_router.presets.create_presets_chat_completions()`:  `request` **Changed** **Breaking** :warning:\n* `open_router.chat.send()`:  `request` **Changed** **Breaking** :warning:\n* `open_router.workspaces.set_budget()`: **Added**\n* `open_router.o_auth.create_auth_code()`: \n  *  `request.workspace_id` **Added**\n  *  `error.status[403]` **Added**\n* `open_router.files.download()`: **Added**\n* `open_router.models.get()`: **Added**\n* `open_router.workspaces.list_budgets()`: **Added**\n* `open_router.workspaces.delete_budget()`: **Added**\n* `open_router.datasets.get_benchmarks_artificial_analysis()`: **Added**\n* `open_router.beta.analytics.query_analytics()`:  `response.data.warnings` **Added**\n* `open_router.files.delete()`: **Added**\n* `open_router.files.retrieve()`: **Added**\n* `open_router.files.upload()`: **Added**\n* `open_router.embeddings.list_models()`:  `response.data.[].benchmarks` **Added**\n* `open_router.models.list()`: \n  *  `request` **Changed**\n  *  `response.data.[].benchmarks` **Added**\n* `open_router.models.list_for_user()`:  `response.data.[].benchmarks` **Added**\n* `open_router.files.list()`: **Added**\n* `open_router.presets.create_presets_messages()`:  `request` **Changed**\n* `open_router.datasets.get_benchmarks_design_arena()`: **Added**\n"
+releaseNotes: "## Python SDK Changes:\n* `open_router.beta.responses.send()`: \n  *  `request` **Changed**\n  *  `response.[].data` **Changed** **Breaking** :warning:\n* `open_router.images.list_model_endpoints()`: **Added**\n* `open_router.images.list_models()`: **Added**\n* `open_router.benchmarks.get_benchmarks()`: **Added**\n* `open_router.datasets.get_benchmarks_artificial_analysis()`: **Deleted** **Breaking** :warning:\n* `open_router.datasets.get_benchmarks_design_arena()`: **Deleted** **Breaking** :warning:\n* `open_router.images.generate()`: **Added**\n* `open_router.chat.send()`:  `response` **Changed**\n* `open_router.embeddings.generate()`:  `response.usage` **Changed**\n* `open_router.embeddings.list_models()`:  `response.data.[].reasoning` **Added**\n* `open_router.models.get()`:  `response.data.reasoning` **Added**\n* `open_router.models.list()`:  `response.data.[].reasoning` **Added**\n* `open_router.models.list_for_user()`:  `response.data.[].reasoning` **Added**\n* `open_router.presets.create_presets_responses()`:  `request` **Changed**\n"
diff --git a/.speakeasy/gen.yaml b/.speakeasy/gen.yaml
index 652ef6cc..dec9772a 100644
--- a/.speakeasy/gen.yaml
+++ b/.speakeasy/gen.yaml
@@ -32,7 +32,7 @@ generation:
     skipResponseBodyAssertions: false
   preApplyUnionDiscriminators: true
 python:
-  version: 0.10.0
+  version: 0.10.1
   additionalDependencies:
     dev: {}
     main: {}
diff --git a/.speakeasy/out.openapi.yaml b/.speakeasy/out.openapi.yaml
index 0efe6ba9..c469cc98 100644
--- a/.speakeasy/out.openapi.yaml
+++ b/.speakeasy/out.openapi.yaml
@@ -175,6 +175,7 @@ components:
         effort:
           description: Reasoning effort level for the advisor call.
           enum:
+            - max
             - xhigh
             - high
             - medium
@@ -3642,428 +3643,97 @@ components:
       oneOf:
         - $ref: '#/components/schemas/ContainerAutoEnvironment'
         - $ref: '#/components/schemas/ContainerReferenceEnvironment'
-    BenchmarkPricing:
-      description: OpenRouter pricing per token for this model. Null if pricing is unavailable.
+    BigNumberUnion:
+      description: Price per million prompt tokens
+      example: 1000
+      type: string
+    BooleanCapability:
+      description: A supported-or-not flag. Present means the parameter is accepted.
       example:
-        completion: '0.000015'
-        prompt: '0.000003'
-      nullable: true
+        type: boolean
       properties:
-        completion:
-          description: Cost per output token (USD, decimal string).
-          example: '0.000015'
-          type: string
-        prompt:
-          description: Cost per input token (USD, decimal string).
-          example: '0.000003'
+        type:
+          enum:
+            - boolean
           type: string
       required:
-        - prompt
-        - completion
+        - type
       type: object
-    BenchmarksAAItem:
+    BulkAddWorkspaceMembersRequest:
       example:
-        aa_name: GPT-4o
-        agentic_index: 58.3
-        coding_index: 65.8
-        intelligence_index: 71.2
-        model_permaslug: openai/gpt-4o
-        pricing:
-          completion: '0.00001'
-          prompt: '0.0000025'
+        user_ids:
+          - user_abc123
+          - user_def456
       properties:
-        aa_name:
-          description: Model name as listed on Artificial Analysis.
-          example: GPT-4o
-          type: string
-        agentic_index:
-          description: Artificial Analysis Agentic Index composite score. Higher is better.
-          example: 58.3
-          format: double
-          nullable: true
-          type: number
-        coding_index:
-          description: Artificial Analysis Coding Index composite score. Higher is better.
-          example: 65.8
-          format: double
-          nullable: true
-          type: number
-        intelligence_index:
-          description: Artificial Analysis Intelligence Index composite score. Higher is better.
-          example: 71.2
-          format: double
-          nullable: true
-          type: number
-        model_permaslug:
-          description: Stable OpenRouter model identifier.
-          example: openai/gpt-4o
-          type: string
-        pricing:
-          $ref: '#/components/schemas/BenchmarkPricing'
+        user_ids:
+          description: List of user IDs to add to the workspace. Members are assigned the same role they hold in the organization.
+          example:
+            - user_abc123
+            - user_def456
+          items:
+            type: string
+          maxItems: 100
+          minItems: 1
+          type: array
       required:
-        - model_permaslug
-        - aa_name
-        - intelligence_index
-        - coding_index
-        - agentic_index
-        - pricing
+        - user_ids
       type: object
-    BenchmarksAAMeta:
+    BulkAddWorkspaceMembersResponse:
       example:
-        as_of: '2026-06-03T12:00:00Z'
-        citation: 'Source: Artificial Analysis (artificialanalysis.ai) via OpenRouter (openrouter.ai/rankings).'
-        model_count: 50
-        source: artificial-analysis
-        source_url: https://artificialanalysis.ai
-        version: v1
+        added_count: 1
+        data:
+          - created_at: '2025-08-24T10:30:00Z'
+            id: 660e8400-e29b-41d4-a716-446655440000
+            role: member
+            user_id: user_abc123
+            workspace_id: 550e8400-e29b-41d4-a716-446655440000
       properties:
-        as_of:
-          description: ISO-8601 timestamp of when this data was last updated.
-          example: '2026-06-03T12:00:00Z'
-          type: string
-        citation:
-          description: Required attribution when republishing this data.
-          example: 'Source: Artificial Analysis (artificialanalysis.ai) via OpenRouter (openrouter.ai/rankings).'
-          type: string
-        model_count:
-          description: Number of unique models in the response.
+        added_count:
+          description: Number of workspace memberships created or updated
+          example: 2
           type: integer
-        source:
-          description: Data source identifier.
-          enum:
-            - artificial-analysis
-          type: string
-        source_url:
-          description: URL of the upstream data source.
-          enum:
-            - https://artificialanalysis.ai
-          type: string
-        version:
-          description: Dataset version.
-          enum:
-            - v1
-          type: string
+        data:
+          description: List of added workspace memberships
+          items:
+            $ref: '#/components/schemas/WorkspaceMember'
+          type: array
       required:
-        - as_of
-        - version
-        - source
-        - source_url
-        - citation
-        - model_count
+        - data
+        - added_count
       type: object
-    BenchmarksAAResponse:
+    BulkAssignKeysRequest:
       example:
-        data:
-          - aa_name: GPT-4o
-            agentic_index: 58.3
-            coding_index: 65.8
-            intelligence_index: 71.2
-            model_permaslug: openai/gpt-4o
-            pricing:
-              completion: '0.00001'
-              prompt: '0.0000025'
-        meta:
-          as_of: '2026-06-03T12:00:00Z'
-          citation: 'Source: Artificial Analysis (artificialanalysis.ai) via OpenRouter (openrouter.ai/rankings).'
-          model_count: 1
-          source: artificial-analysis
-          source_url: https://artificialanalysis.ai
-          version: v1
+        key_hashes:
+          - c56454edb818d6b14bc0d61c46025f1450b0f4012d12304ab40aacb519fcbc93
       properties:
-        data:
+        key_hashes:
+          description: Array of API key hashes to assign to the guardrail
+          example:
+            - c56454edb818d6b14bc0d61c46025f1450b0f4012d12304ab40aacb519fcbc93
           items:
-            $ref: '#/components/schemas/BenchmarksAAItem'
+            minLength: 1
+            type: string
+          minItems: 1
           type: array
-        meta:
-          $ref: '#/components/schemas/BenchmarksAAMeta'
       required:
-        - data
-        - meta
+        - key_hashes
       type: object
-    BenchmarksDAItem:
+    BulkAssignKeysResponse:
       example:
-        arena: models
-        avg_generation_time_ms: 3200
-        category: codecategories
-        display_name: Claude Sonnet 4
-        elo: 1423
-        model_permaslug: anthropic/claude-sonnet-4
-        pricing:
-          completion: '0.000015'
-          prompt: '0.000003'
-        tournament_stats:
-          first_place: 12
-          fourth_place: 2
-          second_place: 8
-          third_place: 5
-          total: 27
-        win_rate: 72
+        assigned_count: 3
       properties:
-        arena:
-          description: Arena this ranking belongs to.
-          example: models
-          type: string
-        avg_generation_time_ms:
-          description: Average generation time in milliseconds.
-          example: 3200
-          format: double
-          nullable: true
-          type: number
-        category:
-          description: Category within the arena.
-          example: codecategories
-          type: string
-        display_name:
-          description: Human-readable model name from Design Arena.
-          example: Claude Sonnet 4
-          type: string
-        elo:
-          description: ELO rating from head-to-head arena battles.
-          example: 1423
-          format: double
-          type: number
-        model_permaslug:
-          description: >-
-            Stable OpenRouter model identifier when the model is on OpenRouter; otherwise the upstream Design Arena model id. Use pricing != null to detect OpenRouter-mapped models.
-          example: anthropic/claude-sonnet-4
-          type: string
-        pricing:
-          $ref: '#/components/schemas/BenchmarkPricing'
-        tournament_stats:
-          description: Placement distribution from tournament matches.
-          properties:
-            first_place:
-              nullable: true
-              type: integer
-            fourth_place:
-              nullable: true
-              type: integer
-            second_place:
-              nullable: true
-              type: integer
-            third_place:
-              nullable: true
-              type: integer
-            total:
-              nullable: true
-              type: integer
-          required:
-            - first_place
-            - second_place
-            - third_place
-            - fourth_place
-            - total
-          type: object
-        win_rate:
-          description: Win rate as a percentage (0–100).
-          example: 72
-          format: double
-          type: number
+        assigned_count:
+          description: Number of keys successfully assigned
+          example: 3
+          type: integer
       required:
-        - model_permaslug
-        - display_name
-        - arena
-        - category
-        - elo
-        - win_rate
-        - avg_generation_time_ms
-        - tournament_stats
-        - pricing
+        - assigned_count
       type: object
-    BenchmarksDAMeta:
+    BulkAssignMembersRequest:
       example:
-        arena: models
-        as_of: '2026-06-03T12:00:00Z'
-        category: null
-        citation: 'Source: Design Arena (www.designarena.ai) via OpenRouter (openrouter.ai/rankings).'
-        elo_bounds:
-          max: 1600
-          min: 900
-        model_count: 50
-        source: design-arena
-        source_url: https://www.designarena.ai
-        version: v1
-      properties:
-        arena:
-          description: The arena filter applied.
-          type: string
-        as_of:
-          description: ISO-8601 timestamp of when this data was generated.
-          example: '2026-06-03T12:00:00Z'
-          type: string
-        category:
-          description: The category filter applied, or null if showing all.
-          nullable: true
-          type: string
-        citation:
-          description: Required attribution when republishing this data.
-          example: 'Source: Design Arena (www.designarena.ai) via OpenRouter (openrouter.ai/rankings).'
-          type: string
-        elo_bounds:
-          description: ELO range across all returned models for normalization.
-          properties:
-            max:
-              description: Maximum ELO in the result set.
-              format: double
-              type: number
-            min:
-              description: Minimum ELO in the result set.
-              format: double
-              type: number
-          required:
-            - min
-            - max
-          type: object
-        model_count:
-          description: Number of unique models in the response.
-          type: integer
-        source:
-          description: Data source identifier.
-          enum:
-            - design-arena
-          type: string
-        source_url:
-          description: URL of the upstream data source.
-          enum:
-            - https://www.designarena.ai
-          type: string
-        version:
-          description: Dataset version.
-          enum:
-            - v1
-          type: string
-      required:
-        - as_of
-        - version
-        - source
-        - source_url
-        - citation
-        - model_count
-        - arena
-        - category
-        - elo_bounds
-      type: object
-    BenchmarksDAResponse:
-      example:
-        data:
-          - arena: models
-            avg_generation_time_ms: 3200
-            category: codecategories
-            display_name: Claude Sonnet 4
-            elo: 1423
-            model_permaslug: anthropic/claude-sonnet-4
-            pricing:
-              completion: '0.000015'
-              prompt: '0.000003'
-            tournament_stats:
-              first_place: 12
-              fourth_place: 2
-              second_place: 8
-              third_place: 5
-              total: 27
-            win_rate: 72
-        meta:
-          arena: models
-          as_of: '2026-06-03T12:00:00Z'
-          category: null
-          citation: 'Source: Design Arena (www.designarena.ai) via OpenRouter (openrouter.ai/rankings).'
-          elo_bounds:
-            max: 1600
-            min: 900
-          model_count: 1
-          source: design-arena
-          source_url: https://www.designarena.ai
-          version: v1
-      properties:
-        data:
-          items:
-            $ref: '#/components/schemas/BenchmarksDAItem'
-          type: array
-        meta:
-          $ref: '#/components/schemas/BenchmarksDAMeta'
-      required:
-        - data
-        - meta
-      type: object
-    BigNumberUnion:
-      description: Price per million prompt tokens
-      example: 1000
-      type: string
-    BulkAddWorkspaceMembersRequest:
-      example:
-        user_ids:
-          - user_abc123
-          - user_def456
-      properties:
-        user_ids:
-          description: List of user IDs to add to the workspace. Members are assigned the same role they hold in the organization.
-          example:
-            - user_abc123
-            - user_def456
-          items:
-            type: string
-          maxItems: 100
-          minItems: 1
-          type: array
-      required:
-        - user_ids
-      type: object
-    BulkAddWorkspaceMembersResponse:
-      example:
-        added_count: 1
-        data:
-          - created_at: '2025-08-24T10:30:00Z'
-            id: 660e8400-e29b-41d4-a716-446655440000
-            role: member
-            user_id: user_abc123
-            workspace_id: 550e8400-e29b-41d4-a716-446655440000
-      properties:
-        added_count:
-          description: Number of workspace memberships created or updated
-          example: 2
-          type: integer
-        data:
-          description: List of added workspace memberships
-          items:
-            $ref: '#/components/schemas/WorkspaceMember'
-          type: array
-      required:
-        - data
-        - added_count
-      type: object
-    BulkAssignKeysRequest:
-      example:
-        key_hashes:
-          - c56454edb818d6b14bc0d61c46025f1450b0f4012d12304ab40aacb519fcbc93
-      properties:
-        key_hashes:
-          description: Array of API key hashes to assign to the guardrail
-          example:
-            - c56454edb818d6b14bc0d61c46025f1450b0f4012d12304ab40aacb519fcbc93
-          items:
-            minLength: 1
-            type: string
-          minItems: 1
-          type: array
-      required:
-        - key_hashes
-      type: object
-    BulkAssignKeysResponse:
-      example:
-        assigned_count: 3
-      properties:
-        assigned_count:
-          description: Number of keys successfully assigned
-          example: 3
-          type: integer
-      required:
-        - assigned_count
-      type: object
-    BulkAssignMembersRequest:
-      example:
-        member_user_ids:
-          - user_abc123
-          - user_def456
+        member_user_ids:
+          - user_abc123
+          - user_def456
       properties:
         member_user_ids:
           description: Array of member user IDs to assign to the guardrail
@@ -4359,6 +4029,25 @@ components:
       example: openai
       type: string
       x-speakeasy-unknown-values: allow
+    CapabilityDescriptor:
+      description: A typed descriptor for one supported request parameter.
+      discriminator:
+        mapping:
+          boolean: '#/components/schemas/BooleanCapability'
+          enum: '#/components/schemas/EnumCapability'
+          range: '#/components/schemas/RangeCapability'
+          x-speakeasy-unknown-values: allow
+        propertyName: type
+      example:
+        type: enum
+        values:
+          - 1K
+          - 2K
+          - 4K
+      oneOf:
+        - $ref: '#/components/schemas/EnumCapability'
+        - $ref: '#/components/schemas/RangeCapability'
+        - $ref: '#/components/schemas/BooleanCapability'
     ChatAssistantImages:
       description: Generated images from image generation models
       example:
@@ -5085,6 +4774,7 @@ components:
             effort:
               description: Constrains effort on reasoning for reasoning models
               enum:
+                - max
                 - xhigh
                 - high
                 - medium
@@ -5103,6 +4793,7 @@ components:
           description: >-
             Shorthand for setting reasoning effort. Equivalent to setting reasoning.effort. Cannot be used simultaneously with reasoning.effort if they differ.
           enum:
+            - max
             - xhigh
             - high
             - medium
@@ -5735,6 +5426,9 @@ components:
         prompt_tokens: 10
         prompt_tokens_details:
           cached_tokens: 2
+        server_tool_use_details:
+          tool_calls_executed: 2
+          tool_calls_requested: 2
         total_tokens: 25
       properties:
         completion_tokens:
@@ -5791,6 +5485,25 @@ components:
               description: Video input tokens
               type: integer
           type: object
+        server_tool_use_details:
+          description: Usage for server-side tool execution (e.g., web search)
+          nullable: true
+          properties:
+            tool_calls_executed:
+              description: Number of OpenRouter server tool calls that executed and produced a result
+              nullable: true
+              type: integer
+            tool_calls_requested:
+              description: >-
+                Total number of OpenRouter server-orchestrated tool calls the model requested, across all tool types. Provider-native tools (e.g. native web search) are not counted here.
+              nullable: true
+              type: integer
+            web_search_requests:
+              description: >-
+                Number of web searches performed by server-side tools. For server-orchestrated tool calls a web search is also counted in tool_calls_requested; provider-native web search may report web_search_requests only. Do not sum the two.
+              nullable: true
+              type: integer
+          type: object
         total_tokens:
           description: Total number of tokens
           type: integer
@@ -7204,6 +6917,54 @@ components:
           example: America/New_York
           type: string
       type: object
+    DebugEvent:
+      description: >-
+        Debug event emitted when debug.echo_upstream_body is true. Contains the transformed upstream request body or timing milestones.
+      example:
+        debug:
+          echo_upstream_body:
+            messages: []
+            model: anthropic/claude-sonnet-4
+        sequence_number: 1
+        type: response.debug
+      properties:
+        debug:
+          properties:
+            echo_upstream_body:
+              additionalProperties:
+                nullable: true
+              type: object
+            timings:
+              properties:
+                epoch_ms:
+                  type: integer
+                event:
+                  enum:
+                    - adapter_request
+                    - upstream_headers_received
+                    - first_token_received
+                    - upstream_body_ended
+                  type: string
+                  x-speakeasy-unknown-values: allow
+                start_ms:
+                  type: integer
+              required:
+                - start_ms
+                - event
+                - epoch_ms
+              type: object
+          type: object
+        sequence_number:
+          type: integer
+        type:
+          enum:
+            - response.debug
+          type: string
+      required:
+        - type
+        - debug
+        - sequence_number
+      type: object
     DefaultParameters:
       additionalProperties: false
       description: Default parameters for this model
@@ -7457,6 +7218,27 @@ components:
       example: 0
       type: integer
       x-speakeasy-unknown-values: allow
+    EnumCapability:
+      description: A parameter that accepts one of a discrete set of string values.
+      example:
+        type: enum
+        values:
+          - 1K
+          - 2K
+          - 4K
+      properties:
+        type:
+          enum:
+            - enum
+          type: string
+        values:
+          items:
+            type: string
+          type: array
+      required:
+        - type
+        - values
+      type: object
     ErrorEvent:
       allOf:
         - $ref: '#/components/schemas/BaseErrorEvent'
@@ -8455,6 +8237,8 @@ components:
           maxItems: 8
           minItems: 1
           type: array
+        cache_control:
+          $ref: '#/components/schemas/AnthropicCacheControlDirective'
         max_completion_tokens:
           description: >-
             Maximum number of output tokens (including reasoning tokens) each panelist and the judge model may produce per inner call. Controls the total output budget so reasoning-heavy models like GPT-5.5 do not exhaust their token allowance before producing visible text. When omitted, the provider's default applies.
@@ -8479,6 +8263,7 @@ components:
             effort:
               description: Reasoning effort level for panelist and judge inner calls.
               enum:
+                - max
                 - xhigh
                 - high
                 - medium
@@ -9299,6 +9084,73 @@ components:
         aspect_ratio: '16:9'
         quality: high
       type: object
+    ImageEndpoint:
+      description: An endpoint that serves a given image model.
+      example:
+        allowed_passthrough_parameters: []
+        pricing:
+          - billable: output_image
+            cost_usd: 0.05
+            unit: image
+        provider_name: Bytedance
+        provider_slug: bytedance
+        provider_tag: bytedance
+        supported_parameters:
+          resolution:
+            type: enum
+            values:
+              - 1K
+              - 2K
+              - 4K
+          seed:
+            type: boolean
+        supports_streaming: false
+      properties:
+        allowed_passthrough_parameters:
+          description: Provider-specific options accepted under provider.options[provider_slug].
+          example: []
+          items:
+            type: string
+          type: array
+        pricing:
+          description: Billable pricing lines for this endpoint.
+          example:
+            - billable: output_image
+              cost_usd: 0.05
+              unit: image
+          items:
+            $ref: '#/components/schemas/ImagePricingEntry'
+          type: array
+        provider_name:
+          description: Provider display name
+          example: Bytedance
+          type: string
+        provider_slug:
+          description: Provider slug
+          example: bytedance
+          type: string
+        provider_tag:
+          description: Provider tag for request-side selection
+          example: bytedance
+          nullable: true
+          type: string
+        supported_parameters:
+          allOf:
+            - $ref: '#/components/schemas/SupportedParameters'
+            - description: The definitive set of parameters this endpoint accepts for this model.
+        supports_streaming:
+          description: 'Whether this endpoint supports native SSE streaming (`stream: true` in the request).'
+          example: false
+          type: boolean
+      required:
+        - provider_name
+        - provider_slug
+        - provider_tag
+        - supported_parameters
+        - allowed_passthrough_parameters
+        - supports_streaming
+        - pricing
+      type: object
     ImageGenCallCompletedEvent:
       allOf:
         - $ref: '#/components/schemas/OpenAIResponsesImageGenCallCompleted'
@@ -9345,36 +9197,222 @@ components:
         partial_image_index: 0
         sequence_number: 3
         type: response.image_generation_call.partial_image
-    ImageGenerationServerTool:
-      description: Image generation tool configuration
+    ImageGenCompletedEvent:
+      description: Emitted when generation completes and the final image is available
       example:
-        quality: high
-        type: image_generation
+        b64_json: <base64-encoded-final-image>
+        created: 1748372400
+        type: image_generation.completed
+        usage:
+          completion_tokens: 4175
+          cost: 0.04
+          prompt_tokens: 0
+          total_tokens: 4175
       properties:
-        background:
-          enum:
-            - transparent
-            - opaque
-            - auto
+        b64_json:
+          description: Base64-encoded final image data
           type: string
-          x-speakeasy-unknown-values: allow
-        input_fidelity:
+        created:
+          description: Unix timestamp (seconds) when the image was generated
+          type: integer
+        type:
+          description: The event type
           enum:
-            - high
-            - low
-            - null
-          nullable: true
+            - image_generation.completed
           type: string
-          x-speakeasy-unknown-values: allow
-        input_image_mask:
-          properties:
-            file_id:
-              type: string
-            image_url:
-              type: string
-          type: object
-        model:
-          enum:
+        usage:
+          $ref: '#/components/schemas/ImageGenerationUsage'
+      required:
+        - type
+        - b64_json
+        - created
+      type: object
+    ImageGenerationRequest:
+      description: Image generation request input
+      example:
+        model: bytedance-seed/seedream-4.5
+        prompt: a red panda astronaut floating in space, studio lighting
+      properties:
+        aspect_ratio:
+          description: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+          enum:
+            - '1:1'
+            - '1:2'
+            - '1:4'
+            - '1:8'
+            - '2:1'
+            - '2:3'
+            - '3:2'
+            - '3:4'
+            - '4:1'
+            - '4:3'
+            - '4:5'
+            - '5:4'
+            - '8:1'
+            - '9:16'
+            - '16:9'
+            - '9:19.5'
+            - 19.5:9
+            - '9:20'
+            - '20:9'
+            - '9:21'
+            - '21:9'
+            - auto
+          example: '16:9'
+          type: string
+          x-speakeasy-unknown-values: allow
+        background:
+          description: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+          enum:
+            - auto
+            - transparent
+            - opaque
+          example: auto
+          type: string
+          x-speakeasy-unknown-values: allow
+        input_references:
+          description: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+          items:
+            $ref: '#/components/schemas/ContentPartImage'
+          maxItems: 16
+          type: array
+        model:
+          description: The image generation model to use
+          example: bytedance-seed/seedream-4.5
+          type: string
+        'n':
+          description: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+          example: 1
+          type: integer
+        output_compression:
+          description: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+          example: 100
+          type: integer
+        output_format:
+          description: Encoding of the returned image bytes.
+          enum:
+            - png
+            - jpeg
+            - webp
+          example: png
+          type: string
+          x-speakeasy-unknown-values: allow
+        prompt:
+          description: Text description of the desired image
+          example: a red panda astronaut floating in space, studio lighting
+          minLength: 1
+          type: string
+        provider:
+          description: Provider-specific passthrough configuration
+          properties:
+            options:
+              allOf:
+                - $ref: '#/components/schemas/ProviderOptions'
+                - example:
+                    black-forest-labs:
+                      guidance: 3
+                      steps: 40
+          type: object
+        quality:
+          description: Rendering quality. Providers without a quality knob ignore this.
+          enum:
+            - auto
+            - low
+            - medium
+            - high
+          example: high
+          type: string
+          x-speakeasy-unknown-values: allow
+        resolution:
+          description: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+          enum:
+            - '512'
+            - 1K
+            - 2K
+            - 4K
+          example: 2K
+          type: string
+          x-speakeasy-unknown-values: allow
+        seed:
+          description: >-
+            If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+          type: integer
+        size:
+          description: >-
+            Optional. A convenience shorthand for output dimensions — pass a tier ("2K", "4K") or explicit pixels ("2048x2048") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+          example: 2K
+          type: string
+        stream:
+          description: >-
+            If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+          type: boolean
+      required:
+        - model
+        - prompt
+      type: object
+    ImageGenerationResponse:
+      description: Image generation response
+      example:
+        created: 1748372400
+        data:
+          - b64_json: <base64-encoded-image>
+        usage:
+          completion_tokens: 4175
+          cost: 0.04
+          prompt_tokens: 0
+          total_tokens: 4175
+      properties:
+        created:
+          description: Unix timestamp (seconds) when the image was generated
+          example: 1748372400
+          type: integer
+        data:
+          description: Generated images
+          items:
+            properties:
+              b64_json:
+                description: Base64-encoded image bytes
+                type: string
+            required:
+              - b64_json
+            type: object
+          type: array
+        usage:
+          $ref: '#/components/schemas/ImageGenerationUsage'
+      required:
+        - created
+        - data
+      type: object
+    ImageGenerationServerTool:
+      description: Image generation tool configuration
+      example:
+        quality: high
+        type: image_generation
+      properties:
+        background:
+          enum:
+            - transparent
+            - opaque
+            - auto
+          type: string
+          x-speakeasy-unknown-values: allow
+        input_fidelity:
+          enum:
+            - high
+            - low
+            - null
+          nullable: true
+          type: string
+          x-speakeasy-unknown-values: allow
+        input_image_mask:
+          properties:
+            file_id:
+              type: string
+            image_url:
+              type: string
+          type: object
+        model:
+          enum:
             - gpt-image-1
             - gpt-image-1-mini
           type: string
@@ -9467,6 +9505,382 @@ components:
       example: completed
       type: string
       x-speakeasy-unknown-values: allow
+    ImageGenerationUsage:
+      description: Token and cost usage for the image generation request, when available
+      example:
+        completion_tokens: 4175
+        cost: 0.04
+        prompt_tokens: 0
+        total_tokens: 4175
+      properties:
+        completion_tokens:
+          description: The tokens generated
+          type: integer
+        completion_tokens_details:
+          nullable: true
+          properties:
+            audio_tokens:
+              description: Tokens generated by the model for audio output.
+              nullable: true
+              type: integer
+            image_tokens:
+              description: Tokens generated by the model for image output.
+              nullable: true
+              type: integer
+            reasoning_tokens:
+              description: Tokens generated by the model for reasoning.
+              nullable: true
+              type: integer
+          type: object
+        cost:
+          description: Cost of the completion
+          format: double
+          nullable: true
+          type: number
+        cost_details:
+          $ref: '#/components/schemas/CostDetails'
+        is_byok:
+          description: Whether a request was made using a Bring Your Own Key configuration
+          type: boolean
+        iterations:
+          items:
+            $ref: '#/components/schemas/AnthropicUsageIteration'
+          nullable: true
+          type: array
+        prompt_tokens:
+          description: Including images, input audio, and tools if any
+          type: integer
+        prompt_tokens_details:
+          description: Breakdown of tokens used in the prompt.
+          nullable: true
+          properties:
+            audio_tokens:
+              description: Tokens used for input audio.
+              nullable: true
+              type: integer
+            cache_write_tokens:
+              description: Tokens written to cache. Only returned for models with explicit caching and cache write pricing.
+              nullable: true
+              type: integer
+            cached_tokens:
+              description: Tokens cached by the endpoint.
+              nullable: true
+              type: integer
+            file_tokens:
+              description: Tokens used for input files/documents.
+              nullable: true
+              type: integer
+            video_tokens:
+              description: Tokens used for input video.
+              nullable: true
+              type: integer
+          type: object
+        server_tool_use:
+          description: Usage for server-side tool execution (e.g., web search)
+          nullable: true
+          properties:
+            tool_calls_executed:
+              description: Number of OpenRouter server tool calls that executed and produced a result.
+              nullable: true
+              type: integer
+            tool_calls_requested:
+              description: >-
+                Total number of OpenRouter server-orchestrated tool calls the model requested, across all tool types. Provider-native tools (e.g. native web search) are not counted here.
+              nullable: true
+              type: integer
+            web_search_requests:
+              description: >-
+                Number of web searches performed by server-side tools. For server-orchestrated tool calls a web search is also counted in tool_calls_requested; provider-native web search may report web_search_requests only. Do not sum the two.
+              nullable: true
+              type: integer
+          type: object
+        service_tier:
+          description: The service tier used by the upstream provider for this request
+          nullable: true
+          type: string
+        speed:
+          $ref: '#/components/schemas/AnthropicSpeed'
+        total_tokens:
+          description: Sum of the above two fields
+          type: integer
+      required:
+        - prompt_tokens
+        - completion_tokens
+        - total_tokens
+      type: object
+    ImageGenPartialImageEvent:
+      description: Emitted when a partial image becomes available during streaming generation
+      example:
+        b64_json: <base64-encoded-partial-image>
+        partial_image_index: 0
+        type: image_generation.partial_image
+      properties:
+        b64_json:
+          description: Base64-encoded partial image data
+          type: string
+        partial_image_index:
+          description: 0-based index indicating which partial image this is in the sequence
+          type: integer
+        type:
+          description: The event type
+          enum:
+            - image_generation.partial_image
+          type: string
+      required:
+        - type
+        - partial_image_index
+        - b64_json
+      type: object
+    ImageGenStreamErrorEvent:
+      description: Emitted when streaming generation fails after the SSE response starts
+      example:
+        error:
+          code: upstream_error
+          message: The upstream provider returned an error
+          param: null
+          type: provider_error
+        type: error
+      properties:
+        error:
+          description: Provider error details
+          properties:
+            code:
+              description: Provider error code, when supplied
+              nullable: true
+              type: string
+            message:
+              description: Provider error message
+              type: string
+            param:
+              description: Request parameter associated with the error, when supplied
+              nullable: true
+              type: string
+            type:
+              description: Provider error type, when supplied
+              nullable: true
+              type: string
+          required:
+            - message
+          type: object
+        type:
+          description: The event type
+          enum:
+            - error
+          type: string
+      required:
+        - type
+        - error
+      type: object
+    ImageModelArchitecture:
+      example:
+        input_modalities:
+          - text
+          - image
+        output_modalities:
+          - image
+      properties:
+        input_modalities:
+          description: Supported input modalities
+          items:
+            $ref: '#/components/schemas/InputModality'
+          type: array
+        output_modalities:
+          description: Supported output modalities
+          items:
+            $ref: '#/components/schemas/ImageOutputModality'
+          type: array
+      required:
+        - input_modalities
+        - output_modalities
+      type: object
+    ImageModelEndpointsResponse:
+      description: The full per-endpoint records for an image model.
+      example:
+        endpoints:
+          - allowed_passthrough_parameters: []
+            pricing:
+              - billable: output_image
+                cost_usd: 0.05
+                unit: image
+            provider_name: Bytedance
+            provider_slug: bytedance
+            provider_tag: bytedance
+            supported_parameters:
+              resolution:
+                type: enum
+                values:
+                  - 1K
+                  - 2K
+                  - 4K
+            supports_streaming: false
+        id: bytedance-seed/seedream-4.5
+      properties:
+        endpoints:
+          items:
+            $ref: '#/components/schemas/ImageEndpoint'
+          type: array
+        id:
+          description: Model slug
+          example: bytedance-seed/seedream-4.5
+          type: string
+      required:
+        - id
+        - endpoints
+      type: object
+    ImageModelListItem:
+      description: A single image model in the discovery listing.
+      example:
+        architecture:
+          input_modalities:
+            - text
+            - image
+          output_modalities:
+            - image
+        created: 1692901234
+        description: A text-to-image model.
+        endpoints: /api/v1/images/models/bytedance-seed/seedream-4.5/endpoints
+        id: bytedance-seed/seedream-4.5
+        name: Seedream 4.5
+        supported_parameters:
+          resolution:
+            type: enum
+            values:
+              - 1K
+              - 2K
+              - 4K
+          seed:
+            type: boolean
+        supports_streaming: false
+      properties:
+        architecture:
+          $ref: '#/components/schemas/ImageModelArchitecture'
+        created:
+          description: Unix timestamp (seconds) of when the model was created
+          example: 1692901234
+          type: integer
+        description:
+          example: A text-to-image model.
+          type: string
+        endpoints:
+          description: Relative URL to the full per-endpoint records for this model
+          example: /api/v1/images/models/bytedance-seed/seedream-4.5/endpoints
+          type: string
+        id:
+          description: Model slug
+          example: bytedance-seed/seedream-4.5
+          type: string
+        name:
+          description: Display name
+          example: Seedream 4.5
+          type: string
+        supported_parameters:
+          $ref: '#/components/schemas/SupportedParameters'
+        supports_streaming:
+          description: >-
+            Whether any endpoint of this model supports native SSE streaming on the dedicated Image API (i.e. `stream: true` in the request). OR across endpoints.
+          example: false
+          type: boolean
+      required:
+        - id
+        - name
+        - description
+        - created
+        - architecture
+        - supported_parameters
+        - supports_streaming
+        - endpoints
+      type: object
+    ImageModelsListResponse:
+      description: List of image generation models.
+      example:
+        data:
+          - architecture:
+              input_modalities:
+                - text
+              output_modalities:
+                - image
+            created: 1692901234
+            description: A text-to-image model.
+            endpoints: /api/v1/images/models/bytedance-seed/seedream-4.5/endpoints
+            id: bytedance-seed/seedream-4.5
+            name: Seedream 4.5
+            supported_parameters:
+              resolution:
+                type: enum
+                values:
+                  - 1K
+                  - 2K
+                  - 4K
+            supports_streaming: false
+      properties:
+        data:
+          items:
+            $ref: '#/components/schemas/ImageModelListItem'
+          type: array
+      required:
+        - data
+      type: object
+    ImageOutputModality:
+      enum:
+        - text
+        - image
+        - embeddings
+        - audio
+        - video
+        - rerank
+        - speech
+        - transcription
+      example: image
+      type: string
+      x-speakeasy-unknown-values: allow
+    ImagePricingEntry:
+      description: One billable pricing line for an image provider.
+      example:
+        billable: output_image
+        cost_usd: 0.05
+        unit: image
+      properties:
+        billable:
+          enum:
+            - output_image
+            - input_image
+            - input_font
+            - input_reference
+            - input_text
+          type: string
+          x-speakeasy-unknown-values: allow
+        cost_usd:
+          format: double
+          type: number
+        unit:
+          enum:
+            - image
+            - megapixel
+            - token
+          type: string
+          x-speakeasy-unknown-values: allow
+        variant:
+          type: string
+      required:
+        - billable
+        - unit
+        - cost_usd
+      type: object
+    ImageStreamingResponse:
+      example:
+        data:
+          b64_json: <base64-encoded-partial-image>
+          partial_image_index: 0
+          type: image_generation.partial_image
+      properties:
+        data:
+          anyOf:
+            - $ref: '#/components/schemas/ImageGenPartialImageEvent'
+            - $ref: '#/components/schemas/ImageGenCompletedEvent'
+            - $ref: '#/components/schemas/ImageGenStreamErrorEvent'
+      required:
+        - data
+      type: object
     IncompleteDetails:
       example:
         reason: max_output_tokens
@@ -12151,6 +12565,15 @@ components:
           image: '0'
           prompt: '0.00003'
           request: '0'
+        reasoning:
+          default_effort: medium
+          default_enabled: true
+          mandatory: false
+          supported_efforts:
+            - high
+            - medium
+            - low
+            - minimal
         supported_parameters:
           - temperature
           - top_p
@@ -12213,6 +12636,8 @@ components:
           $ref: '#/components/schemas/PerRequestLimits'
         pricing:
           $ref: '#/components/schemas/PublicPricing'
+        reasoning:
+          $ref: '#/components/schemas/ModelReasoning'
         supported_parameters:
           description: List of supported parameters for this model
           items:
@@ -12377,6 +12802,43 @@ components:
       description: Model to use for completion
       example: openai/gpt-4
       type: string
+    ModelReasoning:
+      description: Reasoning effort configuration. Omitted for non-reasoning models and dynamic router models.
+      example:
+        default_effort: medium
+        default_enabled: true
+        mandatory: false
+        supported_efforts:
+          - high
+          - medium
+          - low
+          - minimal
+      properties:
+        default_effort:
+          allOf:
+            - $ref: '#/components/schemas/ReasoningEffort'
+            - description: >-
+                Default reasoning effort when the client enables reasoning without specifying effort. Maps to `reasoning.effort` in chat requests. When `"none"`, prefer omitting effort unless the user explicitly disables reasoning.
+        default_enabled:
+          description: Default reasoning enabled state when the client does not set `reasoning.enabled`.
+          type: boolean
+        mandatory:
+          description: When true, reasoning cannot be disabled and effort "none" is rejected.
+          type: boolean
+        supported_efforts:
+          description: >-
+            Allowed reasoning effort values for this model, in descending effort order (highest first). Null means no allowlist — all gateway effort values are accepted.
+          items:
+            $ref: '#/components/schemas/ReasoningEffort'
+          nullable: true
+          type: array
+        supports_max_tokens:
+          description: >-
+            Present and `true` when the model accepts `reasoning.max_tokens` in requests (Anthropic-style) instead of or in addition to `reasoning.effort`. Omitted otherwise.
+          type: boolean
+      required:
+        - mandatory
+      type: object
     ModelResponse:
       description: Single model response
       example:
@@ -12624,6 +13086,7 @@ components:
               description: Custom HTTP headers to include in requests to this destination.
               type: object
             modelId:
+              description: The name of the tracing project in Arize AX
               minLength: 1
               type: string
             spaceKey:
@@ -18411,6 +18874,26 @@ components:
       example: fp16
       type: string
       x-speakeasy-unknown-values: allow
+    RangeCapability:
+      description: A parameter that accepts any value within an inclusive numeric range.
+      example:
+        max: 100
+        min: 0
+        type: range
+      properties:
+        max:
+          type: number
+        min:
+          type: number
+        type:
+          enum:
+            - range
+          type: string
+      required:
+        - type
+        - min
+        - max
+      type: object
     RankingsDailyItem:
       example:
         date: '2026-05-11'
@@ -18626,6 +19109,7 @@ components:
         type: response.reasoning_text.done
     ReasoningEffort:
       enum:
+        - max
         - xhigh
         - high
         - medium
@@ -18991,6 +19475,8 @@ components:
           type: boolean
         cache_control:
           $ref: '#/components/schemas/AnthropicCacheControlDirective'
+        debug:
+          $ref: '#/components/schemas/ChatDebugOptions'
         frequency_penalty:
           format: double
           nullable: true
@@ -19692,6 +20178,7 @@ components:
           response.created: '#/components/schemas/OpenResponsesCreatedEvent'
           response.custom_tool_call_input.delta: '#/components/schemas/CustomToolCallInputDeltaEvent'
           response.custom_tool_call_input.done: '#/components/schemas/CustomToolCallInputDoneEvent'
+          response.debug: '#/components/schemas/DebugEvent'
           response.failed: '#/components/schemas/StreamEventsResponseFailed'
           response.function_call_arguments.delta: '#/components/schemas/FunctionCallArgsDeltaEvent'
           response.function_call_arguments.done: '#/components/schemas/FunctionCallArgsDoneEvent'
@@ -19791,6 +20278,7 @@ components:
         - $ref: '#/components/schemas/FusionCallAnalysisInProgressEvent'
         - $ref: '#/components/schemas/FusionCallAnalysisCompletedEvent'
         - $ref: '#/components/schemas/FusionCallCompletedEvent'
+        - $ref: '#/components/schemas/DebugEvent'
     StreamEventsResponseCompleted:
       allOf:
         - $ref: '#/components/schemas/CompletedEvent'
@@ -20078,6 +20566,7 @@ components:
         effort:
           description: Reasoning effort level for the subagent call.
           enum:
+            - max
             - xhigh
             - high
             - medium
@@ -20148,6 +20637,25 @@ components:
             $ref: '#/components/schemas/SubagentNestedTool'
           type: array
       type: object
+    SupportedParameters:
+      additionalProperties:
+        $ref: '#/components/schemas/CapabilityDescriptor'
+      description: >-
+        Union of supported parameters across every endpoint of this model. Coarse discovery aid; the definitive per-endpoint set is behind the endpoints URL.
+      example:
+        output_compression:
+          max: 100
+          min: 0
+          type: range
+        resolution:
+          type: enum
+          values:
+            - 1K
+            - 2K
+            - 4K
+        seed:
+          type: boolean
+      type: object
     TextConfig:
       description: Text output configuration including format and verbosity
       example:
@@ -20332,67 +20840,330 @@ components:
       description: >-
         Metadata for observability and tracing. Known keys (trace_id, trace_name, span_name, generation_name, parent_span_id) have special handling. Additional keys are passed through as custom metadata to configured broadcast destinations.
       example:
-        trace_id: trace-abc123
-        trace_name: my-app-trace
+        trace_id: trace-abc123
+        trace_name: my-app-trace
+      properties:
+        generation_name:
+          type: string
+        parent_span_id:
+          type: string
+        span_name:
+          type: string
+        trace_id:
+          type: string
+        trace_name:
+          type: string
+      type: object
+    Truncation:
+      enum:
+        - auto
+        - disabled
+        - null
+      example: auto
+      nullable: true
+      type: string
+      x-speakeasy-unknown-values: allow
+    UnauthorizedResponse:
+      description: Unauthorized - Authentication required or invalid credentials
+      example:
+        error:
+          code: 401
+          message: Missing Authentication header
+      properties:
+        error:
+          $ref: '#/components/schemas/UnauthorizedResponseErrorData'
+        openrouter_metadata:
+          additionalProperties:
+            nullable: true
+          nullable: true
+          type: object
+        user_id:
+          nullable: true
+          type: string
+      required:
+        - error
+      type: object
+    UnauthorizedResponseErrorData:
+      description: Error data for UnauthorizedResponse
+      example:
+        code: 401
+        message: Missing Authentication header
+      properties:
+        code:
+          type: integer
+        message:
+          type: string
+        metadata:
+          additionalProperties:
+            nullable: true
+          nullable: true
+          type: object
+      required:
+        - code
+        - message
+      type: object
+    UnifiedBenchmarkPricing:
+      description: OpenRouter pricing per token for this model. Null if pricing is unavailable.
+      example:
+        completion: '0.000015'
+        prompt: '0.000003'
+      nullable: true
+      properties:
+        completion:
+          description: Cost per output token (USD, decimal string).
+          example: '0.000015'
+          type: string
+        prompt:
+          description: Cost per input token (USD, decimal string).
+          example: '0.000003'
+          type: string
+      required:
+        - prompt
+        - completion
+      type: object
+    UnifiedBenchmarksAAItem:
+      example:
+        agentic_index: 58.3
+        coding_index: 65.8
+        display_name: GPT-4o
+        intelligence_index: 71.2
+        model_permaslug: openai/gpt-4o
+        pricing:
+          completion: '0.00001'
+          prompt: '0.0000025'
+        source: artificial-analysis
+      properties:
+        agentic_index:
+          description: Artificial Analysis Agentic Index composite score. Higher is better.
+          example: 58.3
+          format: double
+          nullable: true
+          type: number
+        coding_index:
+          description: Artificial Analysis Coding Index composite score. Higher is better.
+          example: 65.8
+          format: double
+          nullable: true
+          type: number
+        display_name:
+          description: Model name as listed on Artificial Analysis.
+          example: GPT-4o
+          type: string
+        intelligence_index:
+          description: Artificial Analysis Intelligence Index composite score. Higher is better.
+          example: 71.2
+          format: double
+          nullable: true
+          type: number
+        model_permaslug:
+          description: Stable OpenRouter model identifier.
+          example: openai/gpt-4o
+          type: string
+        pricing:
+          $ref: '#/components/schemas/UnifiedBenchmarkPricing'
+        source:
+          description: Benchmark source discriminator.
+          enum:
+            - artificial-analysis
+          type: string
+      required:
+        - source
+        - model_permaslug
+        - display_name
+        - intelligence_index
+        - coding_index
+        - agentic_index
+        - pricing
+      type: object
+    UnifiedBenchmarksDAItem:
+      example:
+        arena: models
+        avg_generation_time_ms: 3200
+        category: codecategories
+        display_name: Claude Sonnet 4
+        elo: 1423
+        model_permaslug: anthropic/claude-sonnet-4
+        pricing:
+          completion: '0.000015'
+          prompt: '0.000003'
+        source: design-arena
+        tournament_stats:
+          first_place: 12
+          fourth_place: 2
+          second_place: 8
+          third_place: 5
+          total: 27
+        win_rate: 72
+      properties:
+        arena:
+          description: Arena this ranking belongs to.
+          example: models
+          type: string
+        avg_generation_time_ms:
+          description: Average generation time in milliseconds.
+          example: 3200
+          format: double
+          nullable: true
+          type: number
+        category:
+          description: Category within the arena.
+          example: codecategories
+          type: string
+        display_name:
+          description: Human-readable model name from Design Arena.
+          example: Claude Sonnet 4
+          type: string
+        elo:
+          description: ELO rating from head-to-head arena battles.
+          example: 1423
+          format: double
+          type: number
+        model_permaslug:
+          description: Stable OpenRouter model identifier when mapped; otherwise the upstream Design Arena model id.
+          example: anthropic/claude-sonnet-4
+          type: string
+        pricing:
+          $ref: '#/components/schemas/UnifiedBenchmarkPricing'
+        source:
+          description: Benchmark source discriminator.
+          enum:
+            - design-arena
+          type: string
+        tournament_stats:
+          description: Placement distribution from tournament matches.
+          properties:
+            first_place:
+              nullable: true
+              type: integer
+            fourth_place:
+              nullable: true
+              type: integer
+            second_place:
+              nullable: true
+              type: integer
+            third_place:
+              nullable: true
+              type: integer
+            total:
+              nullable: true
+              type: integer
+          required:
+            - first_place
+            - second_place
+            - third_place
+            - fourth_place
+            - total
+          type: object
+        win_rate:
+          description: Win rate as a percentage (0–100).
+          example: 72
+          format: double
+          type: number
+      required:
+        - source
+        - model_permaslug
+        - display_name
+        - arena
+        - category
+        - elo
+        - win_rate
+        - avg_generation_time_ms
+        - tournament_stats
+        - pricing
+      type: object
+    UnifiedBenchmarksMeta:
+      example:
+        as_of: '2026-06-03T12:00:00Z'
+        citation: 'Source: Artificial Analysis (artificialanalysis.ai) via OpenRouter (openrouter.ai/rankings).'
+        model_count: 50
+        source: artificial-analysis
+        source_url: https://artificialanalysis.ai
+        task_type: null
+        version: v1
       properties:
-        generation_name:
-          type: string
-        parent_span_id:
-          type: string
-        span_name:
+        as_of:
+          description: ISO-8601 timestamp of when this data was last updated.
+          example: '2026-06-03T12:00:00Z'
           type: string
-        trace_id:
+        citation:
+          description: >-
+            Required attribution when republishing this data, or null when results span multiple sources (attribute each item individually by its `source` discriminator).
+          example: 'Source: Artificial Analysis (artificialanalysis.ai) via OpenRouter (openrouter.ai/rankings).'
+          nullable: true
           type: string
-        trace_name:
+        model_count:
+          description: Number of unique models in the response.
+          type: integer
+        source:
+          description: The source filter applied, or null when all sources are returned.
+          enum:
+            - artificial-analysis
+            - design-arena
+            - null
+          example: artificial-analysis
+          nullable: true
           type: string
-      type: object
-    Truncation:
-      enum:
-        - auto
-        - disabled
-        - null
-      example: auto
-      nullable: true
-      type: string
-      x-speakeasy-unknown-values: allow
-    UnauthorizedResponse:
-      description: Unauthorized - Authentication required or invalid credentials
-      example:
-        error:
-          code: 401
-          message: Missing Authentication header
-      properties:
-        error:
-          $ref: '#/components/schemas/UnauthorizedResponseErrorData'
-        openrouter_metadata:
-          additionalProperties:
-            nullable: true
+          x-speakeasy-unknown-values: allow
+        source_url:
+          description: URL of the upstream data source, or null when results span multiple sources.
+          example: https://artificialanalysis.ai
           nullable: true
-          type: object
-        user_id:
+          type: string
+        task_type:
+          description: The task_type filter applied, or null if showing all.
           nullable: true
           type: string
+        version:
+          description: Dataset version.
+          enum:
+            - v1
+          type: string
       required:
-        - error
+        - as_of
+        - version
+        - source
+        - source_url
+        - citation
+        - model_count
+        - task_type
       type: object
-    UnauthorizedResponseErrorData:
-      description: Error data for UnauthorizedResponse
+    UnifiedBenchmarksResponse:
       example:
-        code: 401
-        message: Missing Authentication header
+        data:
+          - agentic_index: 58.3
+            coding_index: 65.8
+            display_name: GPT-4o
+            intelligence_index: 71.2
+            model_permaslug: openai/gpt-4o
+            pricing:
+              completion: '0.00001'
+              prompt: '0.0000025'
+            source: artificial-analysis
+        meta:
+          as_of: '2026-06-03T12:00:00Z'
+          citation: null
+          model_count: 1
+          source: null
+          source_url: null
+          task_type: null
+          version: v1
       properties:
-        code:
-          type: integer
-        message:
-          type: string
-        metadata:
-          additionalProperties:
-            nullable: true
-          nullable: true
-          type: object
+        data:
+          items:
+            discriminator:
+              mapping:
+                artificial-analysis: '#/components/schemas/UnifiedBenchmarksAAItem'
+                design-arena: '#/components/schemas/UnifiedBenchmarksDAItem'
+              propertyName: source
+            oneOf:
+              - $ref: '#/components/schemas/UnifiedBenchmarksAAItem'
+              - $ref: '#/components/schemas/UnifiedBenchmarksDAItem'
+          type: array
+        meta:
+          $ref: '#/components/schemas/UnifiedBenchmarksMeta'
       required:
-        - code
-        - message
+        - data
+        - meta
       type: object
     UnprocessableEntityResponse:
       description: Unprocessable Entity - Semantic validation failure
@@ -22886,40 +23657,191 @@ paths:
                   created_at: '2025-08-24T10:30:00Z'
                   id: auth_code_xyz789
               schema:
-                example:
-                  data:
-                    app_id: 12345
-                    created_at: '2025-08-24T10:30:00Z'
-                    id: auth_code_xyz789
-                properties:
-                  data:
-                    description: Auth code data
-                    example:
-                      app_id: 12345
-                      created_at: '2025-08-24T10:30:00Z'
-                      id: auth_code_xyz789
-                    properties:
-                      app_id:
-                        description: The application ID associated with this auth code
-                        example: 12345
-                        type: integer
-                      created_at:
-                        description: ISO 8601 timestamp of when the auth code was created
-                        example: '2025-08-24T10:30:00Z'
-                        type: string
-                      id:
-                        description: The authorization code ID to use in the exchange request
-                        example: auth_code_xyz789
-                        type: string
-                    required:
-                      - id
-                      - app_id
-                      - created_at
-                    type: object
-                required:
-                  - data
-                type: object
-          description: Successfully created authorization code
+                example:
+                  data:
+                    app_id: 12345
+                    created_at: '2025-08-24T10:30:00Z'
+                    id: auth_code_xyz789
+                properties:
+                  data:
+                    description: Auth code data
+                    example:
+                      app_id: 12345
+                      created_at: '2025-08-24T10:30:00Z'
+                      id: auth_code_xyz789
+                    properties:
+                      app_id:
+                        description: The application ID associated with this auth code
+                        example: 12345
+                        type: integer
+                      created_at:
+                        description: ISO 8601 timestamp of when the auth code was created
+                        example: '2025-08-24T10:30:00Z'
+                        type: string
+                      id:
+                        description: The authorization code ID to use in the exchange request
+                        example: auth_code_xyz789
+                        type: string
+                    required:
+                      - id
+                      - app_id
+                      - created_at
+                    type: object
+                required:
+                  - data
+                type: object
+          description: Successfully created authorization code
+        '400':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 400
+                  message: Invalid request parameters
+              schema:
+                $ref: '#/components/schemas/BadRequestResponse'
+          description: Bad Request - Invalid request parameters or malformed input
+        '401':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 401
+                  message: Missing Authentication header
+              schema:
+                $ref: '#/components/schemas/UnauthorizedResponse'
+          description: Unauthorized - Authentication required or invalid credentials
+        '403':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 403
+                  message: Only management keys can perform this operation
+              schema:
+                $ref: '#/components/schemas/ForbiddenResponse'
+          description: Forbidden - Authentication successful but insufficient permissions
+        '409':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 409
+                  message: Resource conflict. Please try again later.
+              schema:
+                $ref: '#/components/schemas/ConflictResponse'
+          description: Conflict - Resource conflict or concurrent modification
+        '500':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 500
+                  message: Internal Server Error
+              schema:
+                $ref: '#/components/schemas/InternalServerResponse'
+          description: Internal Server Error - Unexpected server error
+      summary: Create authorization code
+      tags:
+        - OAuth
+      x-speakeasy-name-override: createAuthCode
+    parameters:
+      - $ref: "#/components/parameters/AppIdentifier"
+      - $ref: "#/components/parameters/AppDisplayName"
+      - $ref: "#/components/parameters/AppCategories"
+  /benchmarks:
+    get:
+      description: >-
+        Unified benchmark endpoint that aggregates scores from multiple benchmark sources (Artificial Analysis, Design Arena). Filter by source to reproduce the exact shapes from the legacy per-source endpoints, or use task_type to find models suited for specific workloads. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
+      operationId: getBenchmarks
+      parameters:
+        - description: >-
+            Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources.
+          in: query
+          name: source
+          required: false
+          schema:
+            description: >-
+              Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources.
+            enum:
+              - artificial-analysis
+              - design-arena
+            example: artificial-analysis
+            type: string
+            x-speakeasy-unknown-values: allow
+        - description: >-
+            Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category.
+          in: query
+          name: task_type
+          required: false
+          schema:
+            description: >-
+              Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category.
+            enum:
+              - coding
+              - intelligence
+              - agentic
+            example: coding
+            type: string
+            x-speakeasy-unknown-values: allow
+        - description: 'Design Arena only: arena to query. Defaults to `models` when source is `design-arena`.'
+          in: query
+          name: arena
+          required: false
+          schema:
+            description: 'Design Arena only: arena to query. Defaults to `models` when source is `design-arena`.'
+            enum:
+              - models
+              - builders
+              - agents
+            example: models
+            type: string
+            x-speakeasy-unknown-values: allow
+        - description: >-
+            Design Arena only: category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
+          in: query
+          name: category
+          required: false
+          schema:
+            description: >-
+              Design Arena only: category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
+            example: codecategories
+            type: string
+        - description: Maximum number of items to return. When omitted, all matching results are returned.
+          in: query
+          name: max_results
+          required: false
+          schema:
+            description: Maximum number of items to return. When omitted, all matching results are returned.
+            example: 50
+            minimum: 1
+            type: integer
+      responses:
+        '200':
+          content:
+            application/json:
+              example:
+                data:
+                  - agentic_index: 58.3
+                    coding_index: 65.8
+                    display_name: GPT-4o
+                    intelligence_index: 71.2
+                    model_permaslug: openai/gpt-4o
+                    pricing:
+                      completion: '0.00001'
+                      prompt: '0.0000025'
+                    source: artificial-analysis
+                meta:
+                  as_of: '2026-06-03T12:00:00Z'
+                  citation: null
+                  model_count: 1
+                  source: null
+                  source_url: null
+                  task_type: null
+                  version: v1
+              schema:
+                $ref: '#/components/schemas/UnifiedBenchmarksResponse'
+          description: Benchmark results filtered by the specified source and optional task type.
         '400':
           content:
             application/json:
@@ -22940,26 +23862,16 @@ paths:
               schema:
                 $ref: '#/components/schemas/UnauthorizedResponse'
           description: Unauthorized - Authentication required or invalid credentials
-        '403':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 403
-                  message: Only management keys can perform this operation
-              schema:
-                $ref: '#/components/schemas/ForbiddenResponse'
-          description: Forbidden - Authentication successful but insufficient permissions
-        '409':
+        '429':
           content:
             application/json:
               example:
                 error:
-                  code: 409
-                  message: Resource conflict. Please try again later.
+                  code: 429
+                  message: Rate limit exceeded
               schema:
-                $ref: '#/components/schemas/ConflictResponse'
-          description: Conflict - Resource conflict or concurrent modification
+                $ref: '#/components/schemas/TooManyRequestsResponse'
+          description: Too Many Requests - Rate limit exceeded
         '500':
           content:
             application/json:
@@ -22970,10 +23882,9 @@ paths:
               schema:
                 $ref: '#/components/schemas/InternalServerResponse'
           description: Internal Server Error - Unexpected server error
-      summary: Create authorization code
+      summary: List Benchmarks
       tags:
-        - OAuth
-      x-speakeasy-name-override: createAuthCode
+        - Benchmarks
     parameters:
       - $ref: "#/components/parameters/AppIdentifier"
       - $ref: "#/components/parameters/AppDisplayName"
@@ -23955,228 +24866,16 @@ paths:
         - description: >-
             Number of ranked apps to skip before the first returned row (0-100). Defaults to 0. `rank` stays absolute, so the first row of `offset=50` is `rank: 51`.
           in: query
-          name: offset
-          required: false
-          schema:
-            default: 0
-            description: >-
-              Number of ranked apps to skip before the first returned row (0-100). Defaults to 0. `rank` stays absolute, so the first row of `offset=50` is `rank: 51`.
-            example: 0
-            maximum: 100
-            minimum: 0
-            nullable: false
-            type: integer
-      responses:
-        '200':
-          content:
-            application/json:
-              example:
-                data:
-                  - app_id: 12345
-                    app_name: Cline
-                    rank: 1
-                    total_requests: 4321
-                    total_tokens: '12345678'
-                  - app_id: 67890
-                    app_name: Roo Code
-                    rank: 2
-                    total_requests: 2109
-                    total_tokens: '9876543'
-                meta:
-                  as_of: '2026-05-12T02:00:00Z'
-                  end_date: '2026-05-11'
-                  start_date: '2026-04-12'
-                  version: v1
-              schema:
-                $ref: '#/components/schemas/AppRankingsResponse'
-          description: >-
-            Apps ranked per the requested `sort`, re-numbered 1..N. `popular` sorts by `total_tokens` descending; `trending` sorts by absolute excess token growth descending and may return fewer than `limit` rows.
-        '400':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 400
-                  message: Invalid request parameters
-              schema:
-                $ref: '#/components/schemas/BadRequestResponse'
-          description: Bad Request - Invalid request parameters or malformed input
-        '401':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 401
-                  message: Missing Authentication header
-              schema:
-                $ref: '#/components/schemas/UnauthorizedResponse'
-          description: Unauthorized - Authentication required or invalid credentials
-        '429':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 429
-                  message: Rate limit exceeded
-              schema:
-                $ref: '#/components/schemas/TooManyRequestsResponse'
-          description: Too Many Requests - Rate limit exceeded
-        '500':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 500
-                  message: Internal Server Error
-              schema:
-                $ref: '#/components/schemas/InternalServerResponse'
-          description: Internal Server Error - Unexpected server error
-      summary: Top apps by token usage
-      tags:
-        - Datasets
-      x-speakeasy-pagination:
-        inputs:
-          - in: parameters
-            name: offset
-            type: offset
-          - in: parameters
-            name: limit
-            type: limit
-        outputs:
-          results: $.data
-        type: offsetLimit
-    parameters:
-      - $ref: "#/components/parameters/AppIdentifier"
-      - $ref: "#/components/parameters/AppDisplayName"
-      - $ref: "#/components/parameters/AppCategories"
-  /datasets/benchmarks/artificial-analysis:
-    get:
-      description: >-
-        Returns composite index scores (Intelligence, Coding, Agentic) from Artificial Analysis for LLM models. Includes OpenRouter pricing per model. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
-      operationId: getBenchmarksArtificialAnalysis
-      parameters:
-        - description: Max results to return (1–100, default 50).
-          in: query
-          name: max_results
-          required: false
-          schema:
-            default: 50
-            description: Max results to return (1–100, default 50).
-            example: 20
-            maximum: 100
-            minimum: 1
-            type: integer
-      responses:
-        '200':
-          content:
-            application/json:
-              example:
-                data:
-                  - aa_name: GPT-4o
-                    agentic_index: 58.3
-                    coding_index: 65.8
-                    intelligence_index: 71.2
-                    model_permaslug: openai/gpt-4o
-                    pricing:
-                      completion: '0.00001'
-                      prompt: '0.0000025'
-                meta:
-                  as_of: '2026-06-03T12:00:00Z'
-                  citation: 'Source: Artificial Analysis (artificialanalysis.ai) via OpenRouter (openrouter.ai/rankings).'
-                  model_count: 1
-                  source: artificial-analysis
-                  source_url: https://artificialanalysis.ai
-                  version: v1
-              schema:
-                $ref: '#/components/schemas/BenchmarksAAResponse'
-          description: Artificial Analysis composite index scores with pricing and attribution metadata.
-        '400':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 400
-                  message: Invalid request parameters
-              schema:
-                $ref: '#/components/schemas/BadRequestResponse'
-          description: Bad Request - Invalid request parameters or malformed input
-        '401':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 401
-                  message: Missing Authentication header
-              schema:
-                $ref: '#/components/schemas/UnauthorizedResponse'
-          description: Unauthorized - Authentication required or invalid credentials
-        '429':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 429
-                  message: Rate limit exceeded
-              schema:
-                $ref: '#/components/schemas/TooManyRequestsResponse'
-          description: Too Many Requests - Rate limit exceeded
-        '500':
-          content:
-            application/json:
-              example:
-                error:
-                  code: 500
-                  message: Internal Server Error
-              schema:
-                $ref: '#/components/schemas/InternalServerResponse'
-          description: Internal Server Error - Unexpected server error
-      summary: Artificial Analysis Benchmark Indices
-      tags:
-        - Datasets
-    parameters:
-      - $ref: "#/components/parameters/AppIdentifier"
-      - $ref: "#/components/parameters/AppDisplayName"
-      - $ref: "#/components/parameters/AppCategories"
-  /datasets/benchmarks/design-arena:
-    get:
-      description: >-
-        Returns ELO ratings from head-to-head arena battles on Design Arena. Filterable by arena (models/builders/agents) and category. Includes OpenRouter pricing per model. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
-      operationId: getBenchmarksDesignArena
-      parameters:
-        - description: Arena to query. Defaults to `models`.
-          in: query
-          name: arena
-          required: false
-          schema:
-            default: models
-            description: Arena to query. Defaults to `models`.
-            enum:
-              - models
-              - builders
-              - agents
-            example: models
-            type: string
-            x-speakeasy-unknown-values: allow
-        - description: >-
-            Category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
-          in: query
-          name: category
-          required: false
-          schema:
-            description: >-
-              Category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
-            example: codecategories
-            type: string
-        - description: 'Max results to return: per category when no category filter is applied (1–100, default 50).'
-          in: query
-          name: max_results
+          name: offset
           required: false
           schema:
-            default: 50
-            description: 'Max results to return: per category when no category filter is applied (1–100, default 50).'
-            example: 20
+            default: 0
+            description: >-
+              Number of ranked apps to skip before the first returned row (0-100). Defaults to 0. `rank` stays absolute, so the first row of `offset=50` is `rank: 51`.
+            example: 0
             maximum: 100
-            minimum: 1
+            minimum: 0
+            nullable: false
             type: integer
       responses:
         '200':
@@ -24184,37 +24883,25 @@ paths:
             application/json:
               example:
                 data:
-                  - arena: models
-                    avg_generation_time_ms: 3200
-                    category: codecategories
-                    display_name: Claude Sonnet 4
-                    elo: 1423
-                    model_permaslug: anthropic/claude-sonnet-4
-                    pricing:
-                      completion: '0.000015'
-                      prompt: '0.000003'
-                    tournament_stats:
-                      first_place: 12
-                      fourth_place: 2
-                      second_place: 8
-                      third_place: 5
-                      total: 27
-                    win_rate: 72
+                  - app_id: 12345
+                    app_name: Cline
+                    rank: 1
+                    total_requests: 4321
+                    total_tokens: '12345678'
+                  - app_id: 67890
+                    app_name: Roo Code
+                    rank: 2
+                    total_requests: 2109
+                    total_tokens: '9876543'
                 meta:
-                  arena: models
-                  as_of: '2026-06-03T12:00:00Z'
-                  category: null
-                  citation: 'Source: Design Arena (www.designarena.ai) via OpenRouter (openrouter.ai/rankings).'
-                  elo_bounds:
-                    max: 1600
-                    min: 900
-                  model_count: 1
-                  source: design-arena
-                  source_url: https://www.designarena.ai
+                  as_of: '2026-05-12T02:00:00Z'
+                  end_date: '2026-05-11'
+                  start_date: '2026-04-12'
                   version: v1
               schema:
-                $ref: '#/components/schemas/BenchmarksDAResponse'
-          description: Design Arena ELO rankings with pricing and attribution metadata.
+                $ref: '#/components/schemas/AppRankingsResponse'
+          description: >-
+            Apps ranked per the requested `sort`, re-numbered 1..N. `popular` sorts by `total_tokens` descending; `trending` sorts by absolute excess token growth descending and may return fewer than `limit` rows.
         '400':
           content:
             application/json:
@@ -24255,9 +24942,20 @@ paths:
               schema:
                 $ref: '#/components/schemas/InternalServerResponse'
           description: Internal Server Error - Unexpected server error
-      summary: Design Arena Benchmark Rankings
+      summary: Top apps by token usage
       tags:
         - Datasets
+      x-speakeasy-pagination:
+        inputs:
+          - in: parameters
+            name: offset
+            type: offset
+          - in: parameters
+            name: limit
+            type: limit
+        outputs:
+          results: $.data
+        type: offsetLimit
     parameters:
       - $ref: "#/components/parameters/AppIdentifier"
       - $ref: "#/components/parameters/AppDisplayName"
@@ -24569,6 +25267,31 @@ paths:
                         example: 0.0001
                         format: double
                         type: number
+                      cost_details:
+                        description: Breakdown of upstream inference costs
+                        example:
+                          upstream_inference_completions_cost: 0.0004
+                          upstream_inference_cost: null
+                          upstream_inference_prompt_cost: 0.0008
+                        nullable: true
+                        properties:
+                          upstream_inference_completions_cost:
+                            format: double
+                            type: number
+                          upstream_inference_cost:
+                            format: double
+                            nullable: true
+                            type: number
+                          upstream_inference_prompt_cost:
+                            format: double
+                            type: number
+                        required:
+                          - upstream_inference_prompt_cost
+                          - upstream_inference_completions_cost
+                        type: object
+                      is_byok:
+                        description: Whether a request was made using a Bring Your Own Key configuration
+                        type: boolean
                       prompt_tokens:
                         description: Number of tokens in the input
                         example: 8
@@ -26729,6 +27452,278 @@ paths:
       - $ref: "#/components/parameters/AppIdentifier"
       - $ref: "#/components/parameters/AppDisplayName"
       - $ref: "#/components/parameters/AppCategories"
+  /images:
+    post:
+      description: Generates an image from a text prompt via the image generation router
+      operationId: createImages
+      requestBody:
+        content:
+          application/json:
+            example:
+              model: bytedance-seed/seedream-4.5
+              prompt: a red panda astronaut floating in space, studio lighting
+            schema:
+              $ref: '#/components/schemas/ImageGenerationRequest'
+        required: true
+      responses:
+        '200':
+          content:
+            application/json:
+              example:
+                created: 1748372400
+                data:
+                  - b64_json: <base64-encoded-image>
+                usage:
+                  completion_tokens: 4175
+                  cost: 0.04
+                  prompt_tokens: 0
+                  total_tokens: 4175
+              schema:
+                $ref: '#/components/schemas/ImageGenerationResponse'
+            text/event-stream:
+              example:
+                data:
+                  b64_json: <base64-encoded-partial-image>
+                  partial_image_index: 0
+                  type: image_generation.partial_image
+              schema:
+                $ref: '#/components/schemas/ImageStreamingResponse'
+              x-speakeasy-sse-sentinel: '[DONE]'
+          description: Image generation response
+        '400':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 400
+                  message: Invalid request parameters
+              schema:
+                $ref: '#/components/schemas/BadRequestResponse'
+          description: Bad Request - Invalid request parameters or malformed input
+        '401':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 401
+                  message: Missing Authentication header
+              schema:
+                $ref: '#/components/schemas/UnauthorizedResponse'
+          description: Unauthorized - Authentication required or invalid credentials
+        '402':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 402
+                  message: Insufficient credits. Add more using https://openrouter.ai/credits
+              schema:
+                $ref: '#/components/schemas/PaymentRequiredResponse'
+          description: Payment Required - Insufficient credits or quota to complete request
+        '403':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 403
+                  message: Only management keys can perform this operation
+              schema:
+                $ref: '#/components/schemas/ForbiddenResponse'
+          description: Forbidden - Authentication successful but insufficient permissions
+        '404':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 404
+                  message: Resource not found
+              schema:
+                $ref: '#/components/schemas/NotFoundResponse'
+          description: Not Found - Resource does not exist
+        '429':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 429
+                  message: Rate limit exceeded
+              schema:
+                $ref: '#/components/schemas/TooManyRequestsResponse'
+          description: Too Many Requests - Rate limit exceeded
+        '500':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 500
+                  message: Internal Server Error
+              schema:
+                $ref: '#/components/schemas/InternalServerResponse'
+          description: Internal Server Error - Unexpected server error
+        '502':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 502
+                  message: Provider returned error
+              schema:
+                $ref: '#/components/schemas/BadGatewayResponse'
+          description: Bad Gateway - Provider/upstream API failure
+        '524':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 524
+                  message: Request timed out. Please try again later.
+              schema:
+                $ref: '#/components/schemas/EdgeNetworkTimeoutResponse'
+          description: Infrastructure Timeout - Provider request timed out at edge network
+        '529':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 529
+                  message: Provider returned error
+              schema:
+                $ref: '#/components/schemas/ProviderOverloadedResponse'
+          description: Provider Overloaded - Provider is temporarily overloaded
+      summary: Generate an image
+      tags:
+        - Images
+      x-speakeasy-name-override: generate
+    parameters:
+      - $ref: "#/components/parameters/AppIdentifier"
+      - $ref: "#/components/parameters/AppDisplayName"
+      - $ref: "#/components/parameters/AppCategories"
+  /images/models:
+    get:
+      description: >-
+        Lists every image generation model with its top-level supported-parameter superset and a URL to its full per-endpoint records.
+      operationId: listImageModels
+      responses:
+        '200':
+          content:
+            application/json:
+              example:
+                data:
+                  - architecture:
+                      input_modalities:
+                        - text
+                      output_modalities:
+                        - image
+                    created: 1692901234
+                    description: A text-to-image model.
+                    endpoints: /api/v1/images/models/bytedance-seed/seedream-4.5/endpoints
+                    id: bytedance-seed/seedream-4.5
+                    name: Seedream 4.5
+                    supported_parameters:
+                      resolution:
+                        type: enum
+                        values:
+                          - 1K
+                          - 2K
+                          - 4K
+                    supports_streaming: false
+              schema:
+                $ref: '#/components/schemas/ImageModelsListResponse'
+          description: List of image generation models
+        '500':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 500
+                  message: Internal Server Error
+              schema:
+                $ref: '#/components/schemas/InternalServerResponse'
+          description: Internal Server Error - Unexpected server error
+      summary: List image generation models
+      tags:
+        - Images
+      x-speakeasy-name-override: listModels
+    parameters:
+      - $ref: "#/components/parameters/AppIdentifier"
+      - $ref: "#/components/parameters/AppDisplayName"
+      - $ref: "#/components/parameters/AppCategories"
+  /images/models/{author}/{slug}/endpoints:
+    get:
+      description: >-
+        Returns the full per-endpoint records for an image model: each endpoint's definitive supported parameters, pricing, and passthrough allowlist.
+      operationId: listImageModelEndpoints
+      parameters:
+        - description: Model author/organization
+          in: path
+          name: author
+          required: true
+          schema:
+            description: Model author/organization
+            example: bytedance-seed
+            type: string
+        - description: Model slug
+          in: path
+          name: slug
+          required: true
+          schema:
+            description: Model slug
+            example: seedream-4.5
+            type: string
+      responses:
+        '200':
+          content:
+            application/json:
+              example:
+                endpoints:
+                  - allowed_passthrough_parameters: []
+                    pricing:
+                      - billable: output_image
+                        cost_usd: 0.05
+                        unit: image
+                    provider_name: Bytedance
+                    provider_slug: bytedance
+                    provider_tag: bytedance
+                    supported_parameters:
+                      resolution:
+                        type: enum
+                        values:
+                          - 1K
+                          - 2K
+                          - 4K
+                    supports_streaming: false
+                id: bytedance-seed/seedream-4.5
+              schema:
+                $ref: '#/components/schemas/ImageModelEndpointsResponse'
+          description: The full per-endpoint records for an image model
+        '404':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 404
+                  message: Resource not found
+              schema:
+                $ref: '#/components/schemas/NotFoundResponse'
+          description: Not Found - Resource does not exist
+        '500':
+          content:
+            application/json:
+              example:
+                error:
+                  code: 500
+                  message: Internal Server Error
+              schema:
+                $ref: '#/components/schemas/InternalServerResponse'
+          description: Internal Server Error - Unexpected server error
+      summary: List endpoints for an image model
+      tags:
+        - Images
+      x-speakeasy-name-override: listModelEndpoints
+    parameters:
+      - $ref: "#/components/parameters/AppIdentifier"
+      - $ref: "#/components/parameters/AppDisplayName"
+      - $ref: "#/components/parameters/AppCategories"
   /key:
     get:
       description: Get information on the API key associated with the current authentication session
@@ -28725,7 +29720,7 @@ paths:
                     id: openai/gpt-4
                     knowledge_cutoff: null
                     links:
-                      details: /api/v1/models/openai/gpt-5.4/endpoints
+                      details: /api/v1/models/openai/gpt-4/endpoints
                     name: GPT-4
                     per_request_limits: null
                     pricing:
@@ -32681,6 +33676,8 @@ tags:
     name: Anthropic Messages
   - description: BYOK endpoints
     name: BYOK
+  - description: Benchmarks endpoints
+    name: Benchmarks
   - description: Chat completion endpoints
     name: Chat
   - description: Credit management endpoints
@@ -32697,6 +33694,8 @@ tags:
     name: Generations
   - description: Guardrails endpoints
     name: Guardrails
+  - description: Images endpoints
+    name: Images
   - description: Model information endpoints
     name: Models
   - description: OAuth authentication endpoints
diff --git a/.speakeasy/workflow.lock b/.speakeasy/workflow.lock
index 8c161448..0764a8f9 100644
--- a/.speakeasy/workflow.lock
+++ b/.speakeasy/workflow.lock
@@ -2,20 +2,20 @@ speakeasyVersion: 1.680.0
 sources:
     OpenRouter API:
         sourceNamespace: open-router-chat-completions-api
-        sourceRevisionDigest: sha256:716ece4a1211eac2ee0e7e5836c7b484cff9bb002bd4e676d9ecad8317ee7941
-        sourceBlobDigest: sha256:12d3dc8e7150ab2c4c5e3d613b01cb5e4dcce52b329eea89ca1fdc656d6fe045
+        sourceRevisionDigest: sha256:43201410686d85c1c5db87219162f57ec232a223fd9874fbf85e9f387ffc0ddc
+        sourceBlobDigest: sha256:4047617acc6ae75f5be3f00e8b4849f77233995517f069aad6e18475971cb633
         tags:
             - latest
-            - speakeasy-sdk-regen-1781312282
+            - speakeasy-sdk-regen-1782149408
             - 1.0.0
 targets:
     open-router:
         source: OpenRouter API
         sourceNamespace: open-router-chat-completions-api
-        sourceRevisionDigest: sha256:716ece4a1211eac2ee0e7e5836c7b484cff9bb002bd4e676d9ecad8317ee7941
-        sourceBlobDigest: sha256:12d3dc8e7150ab2c4c5e3d613b01cb5e4dcce52b329eea89ca1fdc656d6fe045
+        sourceRevisionDigest: sha256:43201410686d85c1c5db87219162f57ec232a223fd9874fbf85e9f387ffc0ddc
+        sourceBlobDigest: sha256:4047617acc6ae75f5be3f00e8b4849f77233995517f069aad6e18475971cb633
         codeSamplesNamespace: open-router-python-code-samples
-        codeSamplesRevisionDigest: sha256:e7d6f4de48a7c63cf15f3a8378f952277cd4c59373c28c61909497853fa769e2
+        codeSamplesRevisionDigest: sha256:b2b4003f747f96242852a5ad43b9909877ecf9e1e47740deafa821d4aa897ef4
 workflow:
     workflowVersion: 1.0.0
     speakeasyVersion: 1.680.0
diff --git a/RELEASES.md b/RELEASES.md
index 3c7e1bf4..bdea4d38 100644
--- a/RELEASES.md
+++ b/RELEASES.md
@@ -28,4 +28,14 @@ Based on:
 ### Generated
 - [python v0.10.0] .
 ### Releases
-- [PyPI v0.10.0] https://pypi.org/project/openrouter/0.10.0 - .
\ No newline at end of file
+- [PyPI v0.10.0] https://pypi.org/project/openrouter/0.10.0 - .
+
+## 2026-06-23 00:51:05
+### Changes
+Based on:
+- OpenAPI Doc  
+- Speakeasy CLI 1.680.0 (2.788.4) https://github.com/speakeasy-api/speakeasy
+### Generated
+- [python v0.10.1] .
+### Releases
+- [PyPI v0.10.1] https://pypi.org/project/openrouter/0.10.1 - .
\ No newline at end of file
diff --git a/docs/components/completiontokensdetails.md b/docs/components/completiontokensdetails.md
deleted file mode 100644
index 79c357c8..00000000
--- a/docs/components/completiontokensdetails.md
+++ /dev/null
@@ -1,13 +0,0 @@
-# CompletionTokensDetails
-
-Detailed completion token usage
-
-
-## Fields
-
-| Field                        | Type                         | Required                     | Description                  |
-| ---------------------------- | ---------------------------- | ---------------------------- | ---------------------------- |
-| `accepted_prediction_tokens` | *OptionalNullable[int]*      | :heavy_minus_sign:           | Accepted prediction tokens   |
-| `audio_tokens`               | *OptionalNullable[int]*      | :heavy_minus_sign:           | Tokens used for audio output |
-| `reasoning_tokens`           | *OptionalNullable[int]*      | :heavy_minus_sign:           | Tokens used for reasoning    |
-| `rejected_prediction_tokens` | *OptionalNullable[int]*      | :heavy_minus_sign:           | Rejected prediction tokens   |
\ No newline at end of file
diff --git a/docs/components/error.md b/docs/components/error.md
deleted file mode 100644
index a64dcf87..00000000
--- a/docs/components/error.md
+++ /dev/null
@@ -1,11 +0,0 @@
-# Error
-
-Error information
-
-
-## Fields
-
-| Field               | Type                | Required            | Description         | Example             |
-| ------------------- | ------------------- | ------------------- | ------------------- | ------------------- |
-| `code`              | *int*               | :heavy_check_mark:  | Error code          | 429                 |
-| `message`           | *str*               | :heavy_check_mark:  | Error message       | Rate limit exceeded |
\ No newline at end of file
diff --git a/docs/components/model.md b/docs/components/model.md
index 8ce3d9d7..edb000fc 100644
--- a/docs/components/model.md
+++ b/docs/components/model.md
@@ -22,6 +22,7 @@ Information about an AI model available on OpenRouter
 | `name`                                                                                                                                                                                                               | *str*                                                                                                                                                                                                                | :heavy_check_mark:                                                                                                                                                                                                   | Display name of the model                                                                                                                                                                                            | GPT-4                                                                                                                                                                                                                |
 | `per_request_limits`                                                                                                                                                                                                 | [Nullable[components.PerRequestLimits]](../components/perrequestlimits.md)                                                                                                                                           | :heavy_check_mark:                                                                                                                                                                                                   | Per-request token limits                                                                                                                                                                                             | {<br/>"completion_tokens": 1000,<br/>"prompt_tokens": 1000<br/>}                                                                                                                                                     |
 | `pricing`                                                                                                                                                                                                            | [components.PublicPricing](../components/publicpricing.md)                                                                                                                                                           | :heavy_check_mark:                                                                                                                                                                                                   | Pricing information for the model                                                                                                                                                                                    | {<br/>"completion": "0.00006",<br/>"image": "0",<br/>"prompt": "0.00003",<br/>"request": "0"<br/>}                                                                                                                   |
+| `reasoning`                                                                                                                                                                                                          | [Optional[components.ModelReasoning]](../components/modelreasoning.md)                                                                                                                                               | :heavy_minus_sign:                                                                                                                                                                                                   | Reasoning effort configuration. Omitted for non-reasoning models and dynamic router models.                                                                                                                          | {<br/>"default_effort": "medium",<br/>"default_enabled": true,<br/>"mandatory": false,<br/>"supported_efforts": [<br/>"high",<br/>"medium",<br/>"low",<br/>"minimal"<br/>]<br/>}                                     |
 | `supported_parameters`                                                                                                                                                                                               | List[[components.Parameter](../components/parameter.md)]                                                                                                                                                             | :heavy_check_mark:                                                                                                                                                                                                   | List of supported parameters for this model                                                                                                                                                                          |                                                                                                                                                                                                                      |
 | `supported_voices`                                                                                                                                                                                                   | List[*str*]                                                                                                                                                                                                          | :heavy_check_mark:                                                                                                                                                                                                   | List of supported voice identifiers for TTS models. Null for non-TTS models.                                                                                                                                         | <nil>                                                                                                                                                                                                                |
 | `top_provider`                                                                                                                                                                                                       | [components.TopProviderInfo](../components/topproviderinfo.md)                                                                                                                                                       | :heavy_check_mark:                                                                                                                                                                                                   | Information about the top provider for this model                                                                                                                                                                    | {<br/>"context_length": 8192,<br/>"is_moderated": true,<br/>"max_completion_tokens": 4096<br/>}                                                                                                                      |
\ No newline at end of file
diff --git a/docs/components/prompttokensdetails.md b/docs/components/prompttokensdetails.md
deleted file mode 100644
index ecc924e0..00000000
--- a/docs/components/prompttokensdetails.md
+++ /dev/null
@@ -1,13 +0,0 @@
-# PromptTokensDetails
-
-Detailed prompt token usage
-
-
-## Fields
-
-| Field                                                                                            | Type                                                                                             | Required                                                                                         | Description                                                                                      |
-| ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ |
-| `audio_tokens`                                                                                   | *Optional[int]*                                                                                  | :heavy_minus_sign:                                                                               | Audio input tokens                                                                               |
-| `cache_write_tokens`                                                                             | *Optional[int]*                                                                                  | :heavy_minus_sign:                                                                               | Tokens written to cache. Only returned for models with explicit caching and cache write pricing. |
-| `cached_tokens`                                                                                  | *Optional[int]*                                                                                  | :heavy_minus_sign:                                                                               | Cached prompt tokens                                                                             |
-| `video_tokens`                                                                                   | *Optional[int]*                                                                                  | :heavy_minus_sign:                                                                               | Video input tokens                                                                               |
\ No newline at end of file
diff --git a/docs/sdks/responses/README.md b/docs/sdks/responses/README.md
index b1c9d9fe..c9601f17 100644
--- a/docs/sdks/responses/README.md
+++ b/docs/sdks/responses/README.md
@@ -46,6 +46,7 @@ with OpenRouter(
 | `x_open_router_metadata`                                                                                                                                                                                                                                                                                                                                                                                             | [Optional[components.MetadataLevel]](../../components/metadatalevel.md)                                                                                                                                                                                                                                                                                                                                              | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.                                                                                                                                                                                                          | enabled                                                                                                                                                                                                                                                                                                                                                                                                              |
 | `background`                                                                                                                                                                                                                                                                                                                                                                                                         | *OptionalNullable[bool]*                                                                                                                                                                                                                                                                                                                                                                                             | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | N/A                                                                                                                                                                                                                                                                                                                                                                                                                  |                                                                                                                                                                                                                                                                                                                                                                                                                      |
 | `cache_control`                                                                                                                                                                                                                                                                                                                                                                                                      | [Optional[components.AnthropicCacheControlDirective]](../../components/anthropiccachecontroldirective.md)                                                                                                                                                                                                                                                                                                            | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.                                                                                                                                                                                                          | {<br/>"type": "ephemeral"<br/>}                                                                                                                                                                                                                                                                                                                                                                                      |
+| `debug`                                                                                                                                                                                                                                                                                                                                                                                                              | [Optional[components.ChatDebugOptions]](../../components/chatdebugoptions.md)                                                                                                                                                                                                                                                                                                                                        | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | Debug options for inspecting request transformations (streaming only)                                                                                                                                                                                                                                                                                                                                                | {<br/>"echo_upstream_body": true<br/>}                                                                                                                                                                                                                                                                                                                                                                               |
 | `frequency_penalty`                                                                                                                                                                                                                                                                                                                                                                                                  | *OptionalNullable[float]*                                                                                                                                                                                                                                                                                                                                                                                            | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | N/A                                                                                                                                                                                                                                                                                                                                                                                                                  |                                                                                                                                                                                                                                                                                                                                                                                                                      |
 | `image_config`                                                                                                                                                                                                                                                                                                                                                                                                       | Dict[str, [components.ImageConfig](../../components/imageconfig.md)]                                                                                                                                                                                                                                                                                                                                                 | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.                                                                                                                                                                                                                                  | {<br/>"aspect_ratio": "16:9",<br/>"quality": "high"<br/>}                                                                                                                                                                                                                                                                                                                                                            |
 | `include`                                                                                                                                                                                                                                                                                                                                                                                                            | List[[components.ResponseIncludesEnum](../../components/responseincludesenum.md)]                                                                                                                                                                                                                                                                                                                                    | :heavy_minus_sign:                                                                                                                                                                                                                                                                                                                                                                                                   | N/A                                                                                                                                                                                                                                                                                                                                                                                                                  |                                                                                                                                                                                                                                                                                                                                                                                                                      |
diff --git a/pyproject.toml b/pyproject.toml
index 396bd51f..b98c0280 100644
--- a/pyproject.toml
+++ b/pyproject.toml
@@ -1,6 +1,6 @@
 [project]
 name = "openrouter"
-version = "0.10.0"
+version = "0.10.1"
 description = "Official Python Client SDK for OpenRouter."
 authors = [{ name = "OpenRouter" },]
 readme = "README-PYPI.md"
diff --git a/src/openrouter/_version.py b/src/openrouter/_version.py
index be619e3b..ade61995 100644
--- a/src/openrouter/_version.py
+++ b/src/openrouter/_version.py
@@ -3,10 +3,10 @@
 import importlib.metadata
 
 __title__: str = "openrouter"
-__version__: str = "0.10.0"
+__version__: str = "0.10.1"
 __openapi_doc_version__: str = "1.0.0"
 __gen_version__: str = "2.788.4"
-__user_agent__: str = "speakeasy-sdk/python 0.10.0 2.788.4 1.0.0 openrouter"
+__user_agent__: str = "speakeasy-sdk/python 0.10.1 2.788.4 1.0.0 openrouter"
 
 try:
     if __package__ is not None:
diff --git a/src/openrouter/benchmarks.py b/src/openrouter/benchmarks.py
new file mode 100644
index 00000000..d29a6859
--- /dev/null
+++ b/src/openrouter/benchmarks.py
@@ -0,0 +1,303 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from .basesdk import BaseSDK
+from openrouter import components, errors, operations, utils
+from openrouter._hooks import HookContext
+from openrouter.types import OptionalNullable, UNSET
+from openrouter.utils import get_security_from_env
+from openrouter.utils.unmarshal_json_response import unmarshal_json_response
+from typing import Any, Mapping, Optional
+
+
+class Benchmarks(BaseSDK):
+    r"""Benchmarks endpoints"""
+
+    def get_benchmarks(
+        self,
+        *,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        source: Optional[operations.Source] = None,
+        task_type: Optional[operations.TaskType] = None,
+        arena: Optional[operations.Arena] = None,
+        category: Optional[str] = None,
+        max_results: Optional[int] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.UnifiedBenchmarksResponse:
+        r"""List Benchmarks
+
+        Unified benchmark endpoint that aggregates scores from multiple benchmark sources (Artificial Analysis, Design Arena). Filter by source to reproduce the exact shapes from the legacy per-source endpoints, or use task_type to find models suited for specific workloads. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
+
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param source: Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources.
+        :param task_type: Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category.
+        :param arena: Design Arena only: arena to query. Defaults to `models` when source is `design-arena`.
+        :param category: Design Arena only: category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
+        :param max_results: Maximum number of items to return. When omitted, all matching results are returned.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.GetBenchmarksRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+            source=source,
+            task_type=task_type,
+            arena=arena,
+            category=category,
+            max_results=max_results,
+        )
+
+        req = self._build_request(
+            method="GET",
+            path="/benchmarks",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=False,
+            request_has_path_params=False,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="application/json",
+            http_headers=http_headers,
+            _globals=operations.GetBenchmarksGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = self.do_request(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="getBenchmarks",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=["400", "401", "429", "4XX", "500", "5XX"],
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            return unmarshal_json_response(
+                components.UnifiedBenchmarksResponse, http_res
+            )
+        if utils.match_response(http_res, "400", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.BadRequestResponseErrorData, http_res
+            )
+            raise errors.BadRequestResponseError(response_data, http_res)
+        if utils.match_response(http_res, "401", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.UnauthorizedResponseErrorData, http_res
+            )
+            raise errors.UnauthorizedResponseError(response_data, http_res)
+        if utils.match_response(http_res, "429", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.TooManyRequestsResponseErrorData, http_res
+            )
+            raise errors.TooManyRequestsResponseError(response_data, http_res)
+        if utils.match_response(http_res, "500", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res
+            )
+            raise errors.InternalServerResponseError(response_data, http_res)
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
+
+    async def get_benchmarks_async(
+        self,
+        *,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        source: Optional[operations.Source] = None,
+        task_type: Optional[operations.TaskType] = None,
+        arena: Optional[operations.Arena] = None,
+        category: Optional[str] = None,
+        max_results: Optional[int] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.UnifiedBenchmarksResponse:
+        r"""List Benchmarks
+
+        Unified benchmark endpoint that aggregates scores from multiple benchmark sources (Artificial Analysis, Design Arena). Filter by source to reproduce the exact shapes from the legacy per-source endpoints, or use task_type to find models suited for specific workloads. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
+
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param source: Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources.
+        :param task_type: Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category.
+        :param arena: Design Arena only: arena to query. Defaults to `models` when source is `design-arena`.
+        :param category: Design Arena only: category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
+        :param max_results: Maximum number of items to return. When omitted, all matching results are returned.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.GetBenchmarksRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+            source=source,
+            task_type=task_type,
+            arena=arena,
+            category=category,
+            max_results=max_results,
+        )
+
+        req = self._build_request_async(
+            method="GET",
+            path="/benchmarks",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=False,
+            request_has_path_params=False,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="application/json",
+            http_headers=http_headers,
+            _globals=operations.GetBenchmarksGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = await self.do_request_async(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="getBenchmarks",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=["400", "401", "429", "4XX", "500", "5XX"],
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            return unmarshal_json_response(
+                components.UnifiedBenchmarksResponse, http_res
+            )
+        if utils.match_response(http_res, "400", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.BadRequestResponseErrorData, http_res
+            )
+            raise errors.BadRequestResponseError(response_data, http_res)
+        if utils.match_response(http_res, "401", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.UnauthorizedResponseErrorData, http_res
+            )
+            raise errors.UnauthorizedResponseError(response_data, http_res)
+        if utils.match_response(http_res, "429", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.TooManyRequestsResponseErrorData, http_res
+            )
+            raise errors.TooManyRequestsResponseError(response_data, http_res)
+        if utils.match_response(http_res, "500", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res
+            )
+            raise errors.InternalServerResponseError(response_data, http_res)
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
diff --git a/src/openrouter/components/__init__.py b/src/openrouter/components/__init__.py
index 2c07302c..a0f2bd73 100644
--- a/src/openrouter/components/__init__.py
+++ b/src/openrouter/components/__init__.py
@@ -29,6 +29,11 @@
         AnnotationAddedEventType,
         AnnotationAddedEventTypedDict,
     )
+    from .anthropicadvisormessageusageiteration import (
+        AnthropicAdvisorMessageUsageIteration,
+        AnthropicAdvisorMessageUsageIterationType,
+        AnthropicAdvisorMessageUsageIterationTypedDict,
+    )
     from .anthropicallowedcallers import AnthropicAllowedCallers
     from .anthropicbase64imagesource import (
         AnthropicBase64ImageSource,
@@ -72,6 +77,11 @@
         AnthropicCitationWebSearchResultLocationType,
         AnthropicCitationWebSearchResultLocationTypedDict,
     )
+    from .anthropiccompactionusageiteration import (
+        AnthropicCompactionUsageIteration,
+        AnthropicCompactionUsageIterationType,
+        AnthropicCompactionUsageIterationTypedDict,
+    )
     from .anthropicdocumentblockparam import (
         AnthropicDocumentBlockParam,
         AnthropicDocumentBlockParamCitations,
@@ -111,6 +121,15 @@
         AnthropicInputTokensTriggerType,
         AnthropicInputTokensTriggerTypedDict,
     )
+    from .anthropiciterationcachecreation import (
+        AnthropicIterationCacheCreation,
+        AnthropicIterationCacheCreationTypedDict,
+    )
+    from .anthropicmessageusageiteration import (
+        AnthropicMessageUsageIteration,
+        AnthropicMessageUsageIterationType,
+        AnthropicMessageUsageIterationTypedDict,
+    )
     from .anthropicplaintextsource import (
         AnthropicPlainTextSource,
         AnthropicPlainTextSourceMediaType,
@@ -124,6 +143,7 @@
         AnthropicSearchResultBlockParamType,
         AnthropicSearchResultBlockParamTypedDict,
     )
+    from .anthropicspeed import AnthropicSpeed
     from .anthropictextblockparam import (
         AnthropicTextBlockParam,
         AnthropicTextBlockParamType,
@@ -147,6 +167,10 @@
         AnthropicToolUsesTriggerType,
         AnthropicToolUsesTriggerTypedDict,
     )
+    from .anthropicunknownusageiteration import (
+        AnthropicUnknownUsageIteration,
+        AnthropicUnknownUsageIterationTypedDict,
+    )
     from .anthropicurlimagesource import (
         AnthropicURLImageSource,
         AnthropicURLImageSourceType,
@@ -157,6 +181,10 @@
         AnthropicURLPdfSourceType,
         AnthropicURLPdfSourceTypedDict,
     )
+    from .anthropicusageiteration import (
+        AnthropicUsageIteration,
+        AnthropicUsageIterationTypedDict,
+    )
     from .anthropicwebsearchresultblockparam import (
         AnthropicWebSearchResultBlockParam,
         AnthropicWebSearchResultBlockParamType,
@@ -276,37 +304,10 @@
         BashServerToolEnvironment,
         BashServerToolEnvironmentTypedDict,
     )
-    from .benchmarkpricing import BenchmarkPricing, BenchmarkPricingTypedDict
-    from .benchmarksaaitem import BenchmarksAAItem, BenchmarksAAItemTypedDict
-    from .benchmarksaameta import (
-        BenchmarksAAMeta,
-        BenchmarksAAMetaSource,
-        BenchmarksAAMetaSourceURL,
-        BenchmarksAAMetaTypedDict,
-        BenchmarksAAMetaVersion,
-    )
-    from .benchmarksaaresponse import (
-        BenchmarksAAResponse,
-        BenchmarksAAResponseTypedDict,
-    )
-    from .benchmarksdaitem import (
-        BenchmarksDAItem,
-        BenchmarksDAItemTypedDict,
-        TournamentStats,
-        TournamentStatsTypedDict,
-    )
-    from .benchmarksdameta import (
-        BenchmarksDAMeta,
-        BenchmarksDAMetaSource,
-        BenchmarksDAMetaSourceURL,
-        BenchmarksDAMetaTypedDict,
-        BenchmarksDAMetaVersion,
-        EloBounds,
-        EloBoundsTypedDict,
-    )
-    from .benchmarksdaresponse import (
-        BenchmarksDAResponse,
-        BenchmarksDAResponseTypedDict,
+    from .booleancapability import (
+        BooleanCapability,
+        BooleanCapabilityType,
+        BooleanCapabilityTypedDict,
     )
     from .bulkaddworkspacemembersrequest import (
         BulkAddWorkspaceMembersRequest,
@@ -358,6 +359,10 @@
     )
     from .byokkey import BYOKKey, BYOKKeyTypedDict
     from .byokproviderslug import BYOKProviderSlug
+    from .capabilitydescriptor import (
+        CapabilityDescriptor,
+        CapabilityDescriptorTypedDict,
+    )
     from .chatassistantimages import (
         ChatAssistantImages,
         ChatAssistantImagesImageURL,
@@ -495,10 +500,10 @@
     from .chatstreamchoice import ChatStreamChoice, ChatStreamChoiceTypedDict
     from .chatstreamchunk import (
         ChatStreamChunk,
+        ChatStreamChunkError,
+        ChatStreamChunkErrorTypedDict,
         ChatStreamChunkObject,
         ChatStreamChunkTypedDict,
-        Error,
-        ErrorTypedDict,
     )
     from .chatstreamdelta import (
         ChatStreamDelta,
@@ -554,11 +559,13 @@
     )
     from .chatusage import (
         ChatUsage,
+        ChatUsageCompletionTokensDetails,
+        ChatUsageCompletionTokensDetailsTypedDict,
+        ChatUsagePromptTokensDetails,
+        ChatUsagePromptTokensDetailsTypedDict,
         ChatUsageTypedDict,
-        CompletionTokensDetails,
-        CompletionTokensDetailsTypedDict,
-        PromptTokensDetails,
-        PromptTokensDetailsTypedDict,
+        ServerToolUseDetails,
+        ServerToolUseDetailsTypedDict,
     )
     from .chatusermessage import (
         ChatUserMessage,
@@ -776,6 +783,16 @@
         DatetimeServerToolConfig,
         DatetimeServerToolConfigTypedDict,
     )
+    from .debugevent import (
+        Debug,
+        DebugEvent,
+        DebugEventType,
+        DebugEventTypedDict,
+        DebugTypedDict,
+        Event,
+        Timings,
+        TimingsTypedDict,
+    )
     from .defaultparameters import DefaultParameters, DefaultParametersTypedDict
     from .deletebyokkeyresponse import (
         DeleteBYOKKeyResponse,
@@ -827,6 +844,11 @@
     from .endpointinfo import EndpointInfo, EndpointInfoTypedDict
     from .endpointsmetadata import EndpointsMetadata, EndpointsMetadataTypedDict
     from .endpointstatus import EndpointStatus
+    from .enumcapability import (
+        EnumCapability,
+        EnumCapabilityType,
+        EnumCapabilityTypedDict,
+    )
     from .errorevent import ErrorEvent, ErrorEventType, ErrorEventTypedDict
     from .filecitation import FileCitation, FileCitationType, FileCitationTypedDict
     from .filedeleteresponse import (
@@ -1040,6 +1062,7 @@
     from .guardrail import Guardrail, GuardrailTypedDict
     from .guardrailinterval import GuardrailInterval
     from .imageconfig import ImageConfig, ImageConfigTypedDict
+    from .imageendpoint import ImageEndpoint, ImageEndpointTypedDict
     from .imagegencallcompletedevent import (
         ImageGenCallCompletedEvent,
         ImageGenCallCompletedEventType,
@@ -1060,9 +1083,35 @@
         ImageGenCallPartialImageEventType,
         ImageGenCallPartialImageEventTypedDict,
     )
+    from .imagegencompletedevent import (
+        ImageGenCompletedEvent,
+        ImageGenCompletedEventType,
+        ImageGenCompletedEventTypedDict,
+    )
+    from .imagegenerationrequest import (
+        ImageGenerationRequest,
+        ImageGenerationRequestAspectRatio,
+        ImageGenerationRequestBackground,
+        ImageGenerationRequestOptions,
+        ImageGenerationRequestOptionsTypedDict,
+        ImageGenerationRequestOutputFormat,
+        ImageGenerationRequestProvider,
+        ImageGenerationRequestProviderTypedDict,
+        ImageGenerationRequestQuality,
+        ImageGenerationRequestResolution,
+        ImageGenerationRequestTypedDict,
+    )
+    from .imagegenerationresponse import (
+        ImageGenerationResponse,
+        ImageGenerationResponseData,
+        ImageGenerationResponseDataTypedDict,
+        ImageGenerationResponseTypedDict,
+    )
     from .imagegenerationservertool import (
-        Background,
         ImageGenerationServerTool,
+        ImageGenerationServerToolBackground,
+        ImageGenerationServerToolOutputFormat,
+        ImageGenerationServerToolQuality,
         ImageGenerationServerToolType,
         ImageGenerationServerToolTypedDict,
         InputFidelity,
@@ -1070,8 +1119,6 @@
         InputImageMaskTypedDict,
         ModelEnum,
         Moderation,
-        OutputFormat,
-        Quality,
         Size,
     )
     from .imagegenerationservertool_openrouter import (
@@ -1088,6 +1135,54 @@
         ImageGenerationServerToolConfigUnionTypedDict,
     )
     from .imagegenerationstatus import ImageGenerationStatus
+    from .imagegenerationusage import (
+        ImageGenerationUsage,
+        ImageGenerationUsageCompletionTokensDetails,
+        ImageGenerationUsageCompletionTokensDetailsTypedDict,
+        ImageGenerationUsagePromptTokensDetails,
+        ImageGenerationUsagePromptTokensDetailsTypedDict,
+        ImageGenerationUsageTypedDict,
+        ServerToolUse,
+        ServerToolUseTypedDict,
+    )
+    from .imagegenpartialimageevent import (
+        ImageGenPartialImageEvent,
+        ImageGenPartialImageEventType,
+        ImageGenPartialImageEventTypedDict,
+    )
+    from .imagegenstreamerrorevent import (
+        ImageGenStreamErrorEvent,
+        ImageGenStreamErrorEventError,
+        ImageGenStreamErrorEventErrorTypedDict,
+        ImageGenStreamErrorEventType,
+        ImageGenStreamErrorEventTypedDict,
+    )
+    from .imagemodelarchitecture import (
+        ImageModelArchitecture,
+        ImageModelArchitectureTypedDict,
+    )
+    from .imagemodelendpointsresponse import (
+        ImageModelEndpointsResponse,
+        ImageModelEndpointsResponseTypedDict,
+    )
+    from .imagemodellistitem import ImageModelListItem, ImageModelListItemTypedDict
+    from .imagemodelslistresponse import (
+        ImageModelsListResponse,
+        ImageModelsListResponseTypedDict,
+    )
+    from .imageoutputmodality import ImageOutputModality
+    from .imagepricingentry import (
+        Billable,
+        ImagePricingEntry,
+        ImagePricingEntryTypedDict,
+        Unit,
+    )
+    from .imagestreamingresponse import (
+        ImageStreamingResponse,
+        ImageStreamingResponseData,
+        ImageStreamingResponseDataTypedDict,
+        ImageStreamingResponseTypedDict,
+    )
     from .incompletedetails import IncompleteDetails, IncompleteDetailsTypedDict, Reason
     from .inputaudio import (
         FormatEnum,
@@ -1436,6 +1531,7 @@
     from .modelbenchmarks import ModelBenchmarks, ModelBenchmarksTypedDict
     from .modelgroup import ModelGroup
     from .modellinks import ModelLinks, ModelLinksTypedDict
+    from .modelreasoning import DefaultEffort, ModelReasoning, ModelReasoningTypedDict
     from .modelresponse import ModelResponse, ModelResponseTypedDict
     from .modelscountresponse import (
         ModelsCountResponse,
@@ -2036,6 +2132,11 @@
     )
     from .publicpricing import PublicPricing, PublicPricingTypedDict
     from .quantization import Quantization
+    from .rangecapability import (
+        RangeCapability,
+        RangeCapabilityType,
+        RangeCapabilityTypedDict,
+    )
     from .rankingsdailyitem import RankingsDailyItem, RankingsDailyItemTypedDict
     from .rankingsdailymeta import (
         RankingsDailyMeta,
@@ -2348,6 +2449,34 @@
         UnauthorizedResponseErrorData,
         UnauthorizedResponseErrorDataTypedDict,
     )
+    from .unifiedbenchmarkpricing import (
+        UnifiedBenchmarkPricing,
+        UnifiedBenchmarkPricingTypedDict,
+    )
+    from .unifiedbenchmarksaaitem import (
+        UnifiedBenchmarksAAItem,
+        UnifiedBenchmarksAAItemSource,
+        UnifiedBenchmarksAAItemTypedDict,
+    )
+    from .unifiedbenchmarksdaitem import (
+        TournamentStats,
+        TournamentStatsTypedDict,
+        UnifiedBenchmarksDAItem,
+        UnifiedBenchmarksDAItemSource,
+        UnifiedBenchmarksDAItemTypedDict,
+    )
+    from .unifiedbenchmarksmeta import (
+        UnifiedBenchmarksMeta,
+        UnifiedBenchmarksMetaSource,
+        UnifiedBenchmarksMetaTypedDict,
+        UnifiedBenchmarksMetaVersion,
+    )
+    from .unifiedbenchmarksresponse import (
+        UnifiedBenchmarksResponse,
+        UnifiedBenchmarksResponseData,
+        UnifiedBenchmarksResponseDataTypedDict,
+        UnifiedBenchmarksResponseTypedDict,
+    )
     from .unprocessableentityresponseerrordata import (
         UnprocessableEntityResponseErrorData,
         UnprocessableEntityResponseErrorDataTypedDict,
@@ -2404,13 +2533,13 @@
         UsageTypedDict,
     )
     from .videogenerationrequest import (
-        AspectRatio,
-        Options,
-        OptionsTypedDict,
-        Resolution,
         VideoGenerationRequest,
+        VideoGenerationRequestAspectRatio,
+        VideoGenerationRequestOptions,
+        VideoGenerationRequestOptionsTypedDict,
         VideoGenerationRequestProvider,
         VideoGenerationRequestProviderTypedDict,
+        VideoGenerationRequestResolution,
         VideoGenerationRequestTypedDict,
     )
     from .videogenerationresponse import (
@@ -2557,6 +2686,9 @@
     "AnnotationAddedEvent",
     "AnnotationAddedEventType",
     "AnnotationAddedEventTypedDict",
+    "AnthropicAdvisorMessageUsageIteration",
+    "AnthropicAdvisorMessageUsageIterationType",
+    "AnthropicAdvisorMessageUsageIterationTypedDict",
     "AnthropicAllowedCallers",
     "AnthropicBase64ImageSource",
     "AnthropicBase64ImageSourceType",
@@ -2584,6 +2716,9 @@
     "AnthropicCitationWebSearchResultLocation",
     "AnthropicCitationWebSearchResultLocationType",
     "AnthropicCitationWebSearchResultLocationTypedDict",
+    "AnthropicCompactionUsageIteration",
+    "AnthropicCompactionUsageIterationType",
+    "AnthropicCompactionUsageIterationTypedDict",
     "AnthropicDocumentBlockParam",
     "AnthropicDocumentBlockParamCitations",
     "AnthropicDocumentBlockParamCitationsTypedDict",
@@ -2609,6 +2744,11 @@
     "AnthropicInputTokensTrigger",
     "AnthropicInputTokensTriggerType",
     "AnthropicInputTokensTriggerTypedDict",
+    "AnthropicIterationCacheCreation",
+    "AnthropicIterationCacheCreationTypedDict",
+    "AnthropicMessageUsageIteration",
+    "AnthropicMessageUsageIterationType",
+    "AnthropicMessageUsageIterationTypedDict",
     "AnthropicPlainTextSource",
     "AnthropicPlainTextSourceMediaType",
     "AnthropicPlainTextSourceType",
@@ -2618,6 +2758,7 @@
     "AnthropicSearchResultBlockParamCitationsTypedDict",
     "AnthropicSearchResultBlockParamType",
     "AnthropicSearchResultBlockParamTypedDict",
+    "AnthropicSpeed",
     "AnthropicTextBlockParam",
     "AnthropicTextBlockParamType",
     "AnthropicTextBlockParamTypedDict",
@@ -2637,6 +2778,10 @@
     "AnthropicURLPdfSource",
     "AnthropicURLPdfSourceType",
     "AnthropicURLPdfSourceTypedDict",
+    "AnthropicUnknownUsageIteration",
+    "AnthropicUnknownUsageIterationTypedDict",
+    "AnthropicUsageIteration",
+    "AnthropicUsageIterationTypedDict",
     "AnthropicWebSearchResultBlockParam",
     "AnthropicWebSearchResultBlockParamType",
     "AnthropicWebSearchResultBlockParamTypedDict",
@@ -2683,7 +2828,6 @@
     "ApplyPatchUpdateFileOperationTypedDict",
     "Architecture",
     "ArchitectureTypedDict",
-    "AspectRatio",
     "AudioURL",
     "AudioURLTypedDict",
     "AutoRouterPlugin",
@@ -2692,7 +2836,6 @@
     "BYOKKey",
     "BYOKKeyTypedDict",
     "BYOKProviderSlug",
-    "Background",
     "BadGatewayResponseErrorData",
     "BadGatewayResponseErrorDataTypedDict",
     "BadRequestResponseErrorData",
@@ -2728,26 +2871,10 @@
     "BashServerToolEnvironmentTypedDict",
     "BashServerToolType",
     "BashServerToolTypedDict",
-    "BenchmarkPricing",
-    "BenchmarkPricingTypedDict",
-    "BenchmarksAAItem",
-    "BenchmarksAAItemTypedDict",
-    "BenchmarksAAMeta",
-    "BenchmarksAAMetaSource",
-    "BenchmarksAAMetaSourceURL",
-    "BenchmarksAAMetaTypedDict",
-    "BenchmarksAAMetaVersion",
-    "BenchmarksAAResponse",
-    "BenchmarksAAResponseTypedDict",
-    "BenchmarksDAItem",
-    "BenchmarksDAItemTypedDict",
-    "BenchmarksDAMeta",
-    "BenchmarksDAMetaSource",
-    "BenchmarksDAMetaSourceURL",
-    "BenchmarksDAMetaTypedDict",
-    "BenchmarksDAMetaVersion",
-    "BenchmarksDAResponse",
-    "BenchmarksDAResponseTypedDict",
+    "Billable",
+    "BooleanCapability",
+    "BooleanCapabilityType",
+    "BooleanCapabilityTypedDict",
     "BulkAddWorkspaceMembersRequest",
     "BulkAddWorkspaceMembersRequestTypedDict",
     "BulkAddWorkspaceMembersResponse",
@@ -2775,6 +2902,8 @@
     "By",
     "Caching",
     "CachingTypedDict",
+    "CapabilityDescriptor",
+    "CapabilityDescriptorTypedDict",
     "ChatAssistantImages",
     "ChatAssistantImagesImageURL",
     "ChatAssistantImagesImageURLTypedDict",
@@ -2872,6 +3001,8 @@
     "ChatStreamChoice",
     "ChatStreamChoiceTypedDict",
     "ChatStreamChunk",
+    "ChatStreamChunkError",
+    "ChatStreamChunkErrorTypedDict",
     "ChatStreamChunkObject",
     "ChatStreamChunkTypedDict",
     "ChatStreamDelta",
@@ -2913,6 +3044,10 @@
     "ChatToolMessageRole",
     "ChatToolMessageTypedDict",
     "ChatUsage",
+    "ChatUsageCompletionTokensDetails",
+    "ChatUsageCompletionTokensDetailsTypedDict",
+    "ChatUsagePromptTokensDetails",
+    "ChatUsagePromptTokensDetailsTypedDict",
     "ChatUsageTypedDict",
     "ChatUserMessage",
     "ChatUserMessageContent",
@@ -2936,8 +3071,6 @@
     "CompactionItem",
     "CompactionItemType",
     "CompactionItemTypedDict",
-    "CompletionTokensDetails",
-    "CompletionTokensDetailsTypedDict",
     "CompoundFilter",
     "CompoundFilterType",
     "CompoundFilterTypedDict",
@@ -3076,6 +3209,12 @@
     "DatetimeServerToolConfigTypedDict",
     "DatetimeServerToolType",
     "DatetimeServerToolTypedDict",
+    "Debug",
+    "DebugEvent",
+    "DebugEventType",
+    "DebugEventTypedDict",
+    "DebugTypedDict",
+    "DefaultEffort",
     "DefaultParameters",
     "DefaultParametersTypedDict",
     "DeleteBYOKKeyResponse",
@@ -3120,20 +3259,20 @@
     "EditCompact20260112TypedDict",
     "EditTypeInputTokens",
     "EditTypedDict",
-    "EloBounds",
-    "EloBoundsTypedDict",
     "EndpointInfo",
     "EndpointInfoTypedDict",
     "EndpointStatus",
     "EndpointsMetadata",
     "EndpointsMetadataTypedDict",
+    "EnumCapability",
+    "EnumCapabilityType",
+    "EnumCapabilityTypedDict",
     "Environment",
-    "Error",
     "ErrorCode",
     "ErrorEvent",
     "ErrorEventType",
     "ErrorEventTypedDict",
-    "ErrorTypedDict",
+    "Event",
     "FailedModel",
     "FailedModelTypedDict",
     "FieldT",
@@ -3291,6 +3430,8 @@
     "IgnoreTypedDict",
     "ImageConfig",
     "ImageConfigTypedDict",
+    "ImageEndpoint",
+    "ImageEndpointTypedDict",
     "ImageGenCallCompletedEvent",
     "ImageGenCallCompletedEventType",
     "ImageGenCallCompletedEventTypedDict",
@@ -3303,7 +3444,34 @@
     "ImageGenCallPartialImageEvent",
     "ImageGenCallPartialImageEventType",
     "ImageGenCallPartialImageEventTypedDict",
+    "ImageGenCompletedEvent",
+    "ImageGenCompletedEventType",
+    "ImageGenCompletedEventTypedDict",
+    "ImageGenPartialImageEvent",
+    "ImageGenPartialImageEventType",
+    "ImageGenPartialImageEventTypedDict",
+    "ImageGenStreamErrorEvent",
+    "ImageGenStreamErrorEventError",
+    "ImageGenStreamErrorEventErrorTypedDict",
+    "ImageGenStreamErrorEventType",
+    "ImageGenStreamErrorEventTypedDict",
+    "ImageGenerationRequest",
+    "ImageGenerationRequestAspectRatio",
+    "ImageGenerationRequestBackground",
+    "ImageGenerationRequestOptions",
+    "ImageGenerationRequestOptionsTypedDict",
+    "ImageGenerationRequestOutputFormat",
+    "ImageGenerationRequestProvider",
+    "ImageGenerationRequestProviderTypedDict",
+    "ImageGenerationRequestQuality",
+    "ImageGenerationRequestResolution",
+    "ImageGenerationRequestTypedDict",
+    "ImageGenerationResponse",
+    "ImageGenerationResponseData",
+    "ImageGenerationResponseDataTypedDict",
+    "ImageGenerationResponseTypedDict",
     "ImageGenerationServerTool",
+    "ImageGenerationServerToolBackground",
     "ImageGenerationServerToolConfig",
     "ImageGenerationServerToolConfigTypedDict",
     "ImageGenerationServerToolConfigUnion",
@@ -3311,9 +3479,32 @@
     "ImageGenerationServerToolOpenRouter",
     "ImageGenerationServerToolOpenRouterType",
     "ImageGenerationServerToolOpenRouterTypedDict",
+    "ImageGenerationServerToolOutputFormat",
+    "ImageGenerationServerToolQuality",
     "ImageGenerationServerToolType",
     "ImageGenerationServerToolTypedDict",
     "ImageGenerationStatus",
+    "ImageGenerationUsage",
+    "ImageGenerationUsageCompletionTokensDetails",
+    "ImageGenerationUsageCompletionTokensDetailsTypedDict",
+    "ImageGenerationUsagePromptTokensDetails",
+    "ImageGenerationUsagePromptTokensDetailsTypedDict",
+    "ImageGenerationUsageTypedDict",
+    "ImageModelArchitecture",
+    "ImageModelArchitectureTypedDict",
+    "ImageModelEndpointsResponse",
+    "ImageModelEndpointsResponseTypedDict",
+    "ImageModelListItem",
+    "ImageModelListItemTypedDict",
+    "ImageModelsListResponse",
+    "ImageModelsListResponseTypedDict",
+    "ImageOutputModality",
+    "ImagePricingEntry",
+    "ImagePricingEntryTypedDict",
+    "ImageStreamingResponse",
+    "ImageStreamingResponseData",
+    "ImageStreamingResponseDataTypedDict",
+    "ImageStreamingResponseTypedDict",
     "IncompleteDetails",
     "IncompleteDetailsTypedDict",
     "Input1",
@@ -3518,6 +3709,8 @@
     "ModelGroup",
     "ModelLinks",
     "ModelLinksTypedDict",
+    "ModelReasoning",
+    "ModelReasoningTypedDict",
     "ModelResponse",
     "ModelResponseTypedDict",
     "ModelTypedDict",
@@ -3711,8 +3904,6 @@
     "OpenRouterWebSearchServerToolType",
     "OpenRouterWebSearchServerToolTypedDict",
     "Operator",
-    "Options",
-    "OptionsTypedDict",
     "Order",
     "OrderTypedDict",
     "Outcome",
@@ -3760,7 +3951,6 @@
     "OutputFileSearchServerToolItem",
     "OutputFileSearchServerToolItemType",
     "OutputFileSearchServerToolItemTypedDict",
-    "OutputFormat",
     "OutputFunctionCallItem",
     "OutputFunctionCallItemStatusCompleted",
     "OutputFunctionCallItemStatusInProgress",
@@ -3927,8 +4117,6 @@
     "Pricing",
     "PricingTypedDict",
     "PromptInjectionScanScope",
-    "PromptTokensDetails",
-    "PromptTokensDetailsTypedDict",
     "ProviderName",
     "ProviderOptions",
     "ProviderOptionsTypedDict",
@@ -3947,8 +4135,10 @@
     "PublicEndpointTypedDict",
     "PublicPricing",
     "PublicPricingTypedDict",
-    "Quality",
     "Quantization",
+    "RangeCapability",
+    "RangeCapabilityType",
+    "RangeCapabilityTypedDict",
     "Ranker",
     "RankingOptions",
     "RankingOptionsTypedDict",
@@ -4024,7 +4214,6 @@
     "RequireApprovalUnion",
     "RequireApprovalUnionTypedDict",
     "ResetInterval",
-    "Resolution",
     "Response",
     "ResponseFormat",
     "ResponseFormatEnum",
@@ -4076,6 +4265,10 @@
     "SearchQualityLevel",
     "Security",
     "SecurityTypedDict",
+    "ServerToolUse",
+    "ServerToolUseDetails",
+    "ServerToolUseDetailsTypedDict",
+    "ServerToolUseTypedDict",
     "ServiceUnavailableResponseErrorData",
     "ServiceUnavailableResponseErrorDataTypedDict",
     "ShellCallItem",
@@ -4192,6 +4385,8 @@
     "ThinkingEnabled",
     "ThinkingEnabledTypedDict",
     "ThinkingTypedDict",
+    "Timings",
+    "TimingsTypedDict",
     "Tokenizer",
     "TooManyRequestsResponseErrorData",
     "TooManyRequestsResponseErrorDataTypedDict",
@@ -4277,8 +4472,25 @@
     "URLCitationTypedDict",
     "UnauthorizedResponseErrorData",
     "UnauthorizedResponseErrorDataTypedDict",
+    "UnifiedBenchmarkPricing",
+    "UnifiedBenchmarkPricingTypedDict",
+    "UnifiedBenchmarksAAItem",
+    "UnifiedBenchmarksAAItemSource",
+    "UnifiedBenchmarksAAItemTypedDict",
+    "UnifiedBenchmarksDAItem",
+    "UnifiedBenchmarksDAItemSource",
+    "UnifiedBenchmarksDAItemTypedDict",
+    "UnifiedBenchmarksMeta",
+    "UnifiedBenchmarksMetaSource",
+    "UnifiedBenchmarksMetaTypedDict",
+    "UnifiedBenchmarksMetaVersion",
+    "UnifiedBenchmarksResponse",
+    "UnifiedBenchmarksResponseData",
+    "UnifiedBenchmarksResponseDataTypedDict",
+    "UnifiedBenchmarksResponseTypedDict",
     "UniqueInsight",
     "UniqueInsightTypedDict",
+    "Unit",
     "UnprocessableEntityResponseErrorData",
     "UnprocessableEntityResponseErrorDataTypedDict",
     "UpdateBYOKKeyRequest",
@@ -4311,8 +4523,12 @@
     "VariablesTypedDict",
     "Verbosity",
     "VideoGenerationRequest",
+    "VideoGenerationRequestAspectRatio",
+    "VideoGenerationRequestOptions",
+    "VideoGenerationRequestOptionsTypedDict",
     "VideoGenerationRequestProvider",
     "VideoGenerationRequestProviderTypedDict",
+    "VideoGenerationRequestResolution",
     "VideoGenerationRequestTypedDict",
     "VideoGenerationResponse",
     "VideoGenerationResponseStatus",
@@ -4401,6 +4617,9 @@
     "AnnotationAddedEvent": ".annotationaddedevent",
     "AnnotationAddedEventType": ".annotationaddedevent",
     "AnnotationAddedEventTypedDict": ".annotationaddedevent",
+    "AnthropicAdvisorMessageUsageIteration": ".anthropicadvisormessageusageiteration",
+    "AnthropicAdvisorMessageUsageIterationType": ".anthropicadvisormessageusageiteration",
+    "AnthropicAdvisorMessageUsageIterationTypedDict": ".anthropicadvisormessageusageiteration",
     "AnthropicAllowedCallers": ".anthropicallowedcallers",
     "AnthropicBase64ImageSource": ".anthropicbase64imagesource",
     "AnthropicBase64ImageSourceType": ".anthropicbase64imagesource",
@@ -4428,6 +4647,9 @@
     "AnthropicCitationWebSearchResultLocation": ".anthropiccitationwebsearchresultlocation",
     "AnthropicCitationWebSearchResultLocationType": ".anthropiccitationwebsearchresultlocation",
     "AnthropicCitationWebSearchResultLocationTypedDict": ".anthropiccitationwebsearchresultlocation",
+    "AnthropicCompactionUsageIteration": ".anthropiccompactionusageiteration",
+    "AnthropicCompactionUsageIterationType": ".anthropiccompactionusageiteration",
+    "AnthropicCompactionUsageIterationTypedDict": ".anthropiccompactionusageiteration",
     "AnthropicDocumentBlockParam": ".anthropicdocumentblockparam",
     "AnthropicDocumentBlockParamCitations": ".anthropicdocumentblockparam",
     "AnthropicDocumentBlockParamCitationsTypedDict": ".anthropicdocumentblockparam",
@@ -4457,6 +4679,11 @@
     "AnthropicInputTokensTrigger": ".anthropicinputtokenstrigger",
     "AnthropicInputTokensTriggerType": ".anthropicinputtokenstrigger",
     "AnthropicInputTokensTriggerTypedDict": ".anthropicinputtokenstrigger",
+    "AnthropicIterationCacheCreation": ".anthropiciterationcachecreation",
+    "AnthropicIterationCacheCreationTypedDict": ".anthropiciterationcachecreation",
+    "AnthropicMessageUsageIteration": ".anthropicmessageusageiteration",
+    "AnthropicMessageUsageIterationType": ".anthropicmessageusageiteration",
+    "AnthropicMessageUsageIterationTypedDict": ".anthropicmessageusageiteration",
     "AnthropicPlainTextSource": ".anthropicplaintextsource",
     "AnthropicPlainTextSourceMediaType": ".anthropicplaintextsource",
     "AnthropicPlainTextSourceType": ".anthropicplaintextsource",
@@ -4466,6 +4693,7 @@
     "AnthropicSearchResultBlockParamCitationsTypedDict": ".anthropicsearchresultblockparam",
     "AnthropicSearchResultBlockParamType": ".anthropicsearchresultblockparam",
     "AnthropicSearchResultBlockParamTypedDict": ".anthropicsearchresultblockparam",
+    "AnthropicSpeed": ".anthropicspeed",
     "AnthropicTextBlockParam": ".anthropictextblockparam",
     "AnthropicTextBlockParamType": ".anthropictextblockparam",
     "AnthropicTextBlockParamTypedDict": ".anthropictextblockparam",
@@ -4481,12 +4709,16 @@
     "AnthropicToolUsesTrigger": ".anthropictoolusestrigger",
     "AnthropicToolUsesTriggerType": ".anthropictoolusestrigger",
     "AnthropicToolUsesTriggerTypedDict": ".anthropictoolusestrigger",
+    "AnthropicUnknownUsageIteration": ".anthropicunknownusageiteration",
+    "AnthropicUnknownUsageIterationTypedDict": ".anthropicunknownusageiteration",
     "AnthropicURLImageSource": ".anthropicurlimagesource",
     "AnthropicURLImageSourceType": ".anthropicurlimagesource",
     "AnthropicURLImageSourceTypedDict": ".anthropicurlimagesource",
     "AnthropicURLPdfSource": ".anthropicurlpdfsource",
     "AnthropicURLPdfSourceType": ".anthropicurlpdfsource",
     "AnthropicURLPdfSourceTypedDict": ".anthropicurlpdfsource",
+    "AnthropicUsageIteration": ".anthropicusageiteration",
+    "AnthropicUsageIterationTypedDict": ".anthropicusageiteration",
     "AnthropicWebSearchResultBlockParam": ".anthropicwebsearchresultblockparam",
     "AnthropicWebSearchResultBlockParamType": ".anthropicwebsearchresultblockparam",
     "AnthropicWebSearchResultBlockParamTypedDict": ".anthropicwebsearchresultblockparam",
@@ -4569,30 +4801,9 @@
     "BashServerToolEngine": ".bashservertoolengine",
     "BashServerToolEnvironment": ".bashservertoolenvironment",
     "BashServerToolEnvironmentTypedDict": ".bashservertoolenvironment",
-    "BenchmarkPricing": ".benchmarkpricing",
-    "BenchmarkPricingTypedDict": ".benchmarkpricing",
-    "BenchmarksAAItem": ".benchmarksaaitem",
-    "BenchmarksAAItemTypedDict": ".benchmarksaaitem",
-    "BenchmarksAAMeta": ".benchmarksaameta",
-    "BenchmarksAAMetaSource": ".benchmarksaameta",
-    "BenchmarksAAMetaSourceURL": ".benchmarksaameta",
-    "BenchmarksAAMetaTypedDict": ".benchmarksaameta",
-    "BenchmarksAAMetaVersion": ".benchmarksaameta",
-    "BenchmarksAAResponse": ".benchmarksaaresponse",
-    "BenchmarksAAResponseTypedDict": ".benchmarksaaresponse",
-    "BenchmarksDAItem": ".benchmarksdaitem",
-    "BenchmarksDAItemTypedDict": ".benchmarksdaitem",
-    "TournamentStats": ".benchmarksdaitem",
-    "TournamentStatsTypedDict": ".benchmarksdaitem",
-    "BenchmarksDAMeta": ".benchmarksdameta",
-    "BenchmarksDAMetaSource": ".benchmarksdameta",
-    "BenchmarksDAMetaSourceURL": ".benchmarksdameta",
-    "BenchmarksDAMetaTypedDict": ".benchmarksdameta",
-    "BenchmarksDAMetaVersion": ".benchmarksdameta",
-    "EloBounds": ".benchmarksdameta",
-    "EloBoundsTypedDict": ".benchmarksdameta",
-    "BenchmarksDAResponse": ".benchmarksdaresponse",
-    "BenchmarksDAResponseTypedDict": ".benchmarksdaresponse",
+    "BooleanCapability": ".booleancapability",
+    "BooleanCapabilityType": ".booleancapability",
+    "BooleanCapabilityTypedDict": ".booleancapability",
     "BulkAddWorkspaceMembersRequest": ".bulkaddworkspacemembersrequest",
     "BulkAddWorkspaceMembersRequestTypedDict": ".bulkaddworkspacemembersrequest",
     "BulkAddWorkspaceMembersResponse": ".bulkaddworkspacemembersresponse",
@@ -4620,6 +4831,8 @@
     "BYOKKey": ".byokkey",
     "BYOKKeyTypedDict": ".byokkey",
     "BYOKProviderSlug": ".byokproviderslug",
+    "CapabilityDescriptor": ".capabilitydescriptor",
+    "CapabilityDescriptorTypedDict": ".capabilitydescriptor",
     "ChatAssistantImages": ".chatassistantimages",
     "ChatAssistantImagesImageURL": ".chatassistantimages",
     "ChatAssistantImagesImageURLTypedDict": ".chatassistantimages",
@@ -4724,10 +4937,10 @@
     "ChatStreamChoice": ".chatstreamchoice",
     "ChatStreamChoiceTypedDict": ".chatstreamchoice",
     "ChatStreamChunk": ".chatstreamchunk",
+    "ChatStreamChunkError": ".chatstreamchunk",
+    "ChatStreamChunkErrorTypedDict": ".chatstreamchunk",
     "ChatStreamChunkObject": ".chatstreamchunk",
     "ChatStreamChunkTypedDict": ".chatstreamchunk",
-    "Error": ".chatstreamchunk",
-    "ErrorTypedDict": ".chatstreamchunk",
     "ChatStreamDelta": ".chatstreamdelta",
     "ChatStreamDeltaRole": ".chatstreamdelta",
     "ChatStreamDeltaTypedDict": ".chatstreamdelta",
@@ -4767,11 +4980,13 @@
     "ChatToolMessageRole": ".chattoolmessage",
     "ChatToolMessageTypedDict": ".chattoolmessage",
     "ChatUsage": ".chatusage",
+    "ChatUsageCompletionTokensDetails": ".chatusage",
+    "ChatUsageCompletionTokensDetailsTypedDict": ".chatusage",
+    "ChatUsagePromptTokensDetails": ".chatusage",
+    "ChatUsagePromptTokensDetailsTypedDict": ".chatusage",
     "ChatUsageTypedDict": ".chatusage",
-    "CompletionTokensDetails": ".chatusage",
-    "CompletionTokensDetailsTypedDict": ".chatusage",
-    "PromptTokensDetails": ".chatusage",
-    "PromptTokensDetailsTypedDict": ".chatusage",
+    "ServerToolUseDetails": ".chatusage",
+    "ServerToolUseDetailsTypedDict": ".chatusage",
     "ChatUserMessage": ".chatusermessage",
     "ChatUserMessageContent": ".chatusermessage",
     "ChatUserMessageContentTypedDict": ".chatusermessage",
@@ -4917,6 +5132,14 @@
     "DatetimeServerToolTypedDict": ".datetimeservertool",
     "DatetimeServerToolConfig": ".datetimeservertoolconfig",
     "DatetimeServerToolConfigTypedDict": ".datetimeservertoolconfig",
+    "Debug": ".debugevent",
+    "DebugEvent": ".debugevent",
+    "DebugEventType": ".debugevent",
+    "DebugEventTypedDict": ".debugevent",
+    "DebugTypedDict": ".debugevent",
+    "Event": ".debugevent",
+    "Timings": ".debugevent",
+    "TimingsTypedDict": ".debugevent",
     "DefaultParameters": ".defaultparameters",
     "DefaultParametersTypedDict": ".defaultparameters",
     "DeleteBYOKKeyResponse": ".deletebyokkeyresponse",
@@ -4957,6 +5180,9 @@
     "EndpointsMetadata": ".endpointsmetadata",
     "EndpointsMetadataTypedDict": ".endpointsmetadata",
     "EndpointStatus": ".endpointstatus",
+    "EnumCapability": ".enumcapability",
+    "EnumCapabilityType": ".enumcapability",
+    "EnumCapabilityTypedDict": ".enumcapability",
     "ErrorEvent": ".errorevent",
     "ErrorEventType": ".errorevent",
     "ErrorEventTypedDict": ".errorevent",
@@ -5120,6 +5346,8 @@
     "GuardrailInterval": ".guardrailinterval",
     "ImageConfig": ".imageconfig",
     "ImageConfigTypedDict": ".imageconfig",
+    "ImageEndpoint": ".imageendpoint",
+    "ImageEndpointTypedDict": ".imageendpoint",
     "ImageGenCallCompletedEvent": ".imagegencallcompletedevent",
     "ImageGenCallCompletedEventType": ".imagegencallcompletedevent",
     "ImageGenCallCompletedEventTypedDict": ".imagegencallcompletedevent",
@@ -5132,8 +5360,28 @@
     "ImageGenCallPartialImageEvent": ".imagegencallpartialimageevent",
     "ImageGenCallPartialImageEventType": ".imagegencallpartialimageevent",
     "ImageGenCallPartialImageEventTypedDict": ".imagegencallpartialimageevent",
-    "Background": ".imagegenerationservertool",
+    "ImageGenCompletedEvent": ".imagegencompletedevent",
+    "ImageGenCompletedEventType": ".imagegencompletedevent",
+    "ImageGenCompletedEventTypedDict": ".imagegencompletedevent",
+    "ImageGenerationRequest": ".imagegenerationrequest",
+    "ImageGenerationRequestAspectRatio": ".imagegenerationrequest",
+    "ImageGenerationRequestBackground": ".imagegenerationrequest",
+    "ImageGenerationRequestOptions": ".imagegenerationrequest",
+    "ImageGenerationRequestOptionsTypedDict": ".imagegenerationrequest",
+    "ImageGenerationRequestOutputFormat": ".imagegenerationrequest",
+    "ImageGenerationRequestProvider": ".imagegenerationrequest",
+    "ImageGenerationRequestProviderTypedDict": ".imagegenerationrequest",
+    "ImageGenerationRequestQuality": ".imagegenerationrequest",
+    "ImageGenerationRequestResolution": ".imagegenerationrequest",
+    "ImageGenerationRequestTypedDict": ".imagegenerationrequest",
+    "ImageGenerationResponse": ".imagegenerationresponse",
+    "ImageGenerationResponseData": ".imagegenerationresponse",
+    "ImageGenerationResponseDataTypedDict": ".imagegenerationresponse",
+    "ImageGenerationResponseTypedDict": ".imagegenerationresponse",
     "ImageGenerationServerTool": ".imagegenerationservertool",
+    "ImageGenerationServerToolBackground": ".imagegenerationservertool",
+    "ImageGenerationServerToolOutputFormat": ".imagegenerationservertool",
+    "ImageGenerationServerToolQuality": ".imagegenerationservertool",
     "ImageGenerationServerToolType": ".imagegenerationservertool",
     "ImageGenerationServerToolTypedDict": ".imagegenerationservertool",
     "InputFidelity": ".imagegenerationservertool",
@@ -5141,8 +5389,6 @@
     "InputImageMaskTypedDict": ".imagegenerationservertool",
     "ModelEnum": ".imagegenerationservertool",
     "Moderation": ".imagegenerationservertool",
-    "OutputFormat": ".imagegenerationservertool",
-    "Quality": ".imagegenerationservertool",
     "Size": ".imagegenerationservertool",
     "ImageGenerationServerToolOpenRouter": ".imagegenerationservertool_openrouter",
     "ImageGenerationServerToolOpenRouterType": ".imagegenerationservertool_openrouter",
@@ -5152,6 +5398,39 @@
     "ImageGenerationServerToolConfigUnion": ".imagegenerationservertoolconfig_union",
     "ImageGenerationServerToolConfigUnionTypedDict": ".imagegenerationservertoolconfig_union",
     "ImageGenerationStatus": ".imagegenerationstatus",
+    "ImageGenerationUsage": ".imagegenerationusage",
+    "ImageGenerationUsageCompletionTokensDetails": ".imagegenerationusage",
+    "ImageGenerationUsageCompletionTokensDetailsTypedDict": ".imagegenerationusage",
+    "ImageGenerationUsagePromptTokensDetails": ".imagegenerationusage",
+    "ImageGenerationUsagePromptTokensDetailsTypedDict": ".imagegenerationusage",
+    "ImageGenerationUsageTypedDict": ".imagegenerationusage",
+    "ServerToolUse": ".imagegenerationusage",
+    "ServerToolUseTypedDict": ".imagegenerationusage",
+    "ImageGenPartialImageEvent": ".imagegenpartialimageevent",
+    "ImageGenPartialImageEventType": ".imagegenpartialimageevent",
+    "ImageGenPartialImageEventTypedDict": ".imagegenpartialimageevent",
+    "ImageGenStreamErrorEvent": ".imagegenstreamerrorevent",
+    "ImageGenStreamErrorEventError": ".imagegenstreamerrorevent",
+    "ImageGenStreamErrorEventErrorTypedDict": ".imagegenstreamerrorevent",
+    "ImageGenStreamErrorEventType": ".imagegenstreamerrorevent",
+    "ImageGenStreamErrorEventTypedDict": ".imagegenstreamerrorevent",
+    "ImageModelArchitecture": ".imagemodelarchitecture",
+    "ImageModelArchitectureTypedDict": ".imagemodelarchitecture",
+    "ImageModelEndpointsResponse": ".imagemodelendpointsresponse",
+    "ImageModelEndpointsResponseTypedDict": ".imagemodelendpointsresponse",
+    "ImageModelListItem": ".imagemodellistitem",
+    "ImageModelListItemTypedDict": ".imagemodellistitem",
+    "ImageModelsListResponse": ".imagemodelslistresponse",
+    "ImageModelsListResponseTypedDict": ".imagemodelslistresponse",
+    "ImageOutputModality": ".imageoutputmodality",
+    "Billable": ".imagepricingentry",
+    "ImagePricingEntry": ".imagepricingentry",
+    "ImagePricingEntryTypedDict": ".imagepricingentry",
+    "Unit": ".imagepricingentry",
+    "ImageStreamingResponse": ".imagestreamingresponse",
+    "ImageStreamingResponseData": ".imagestreamingresponse",
+    "ImageStreamingResponseDataTypedDict": ".imagestreamingresponse",
+    "ImageStreamingResponseTypedDict": ".imagestreamingresponse",
     "IncompleteDetails": ".incompletedetails",
     "IncompleteDetailsTypedDict": ".incompletedetails",
     "Reason": ".incompletedetails",
@@ -5459,6 +5738,9 @@
     "ModelGroup": ".modelgroup",
     "ModelLinks": ".modellinks",
     "ModelLinksTypedDict": ".modellinks",
+    "DefaultEffort": ".modelreasoning",
+    "ModelReasoning": ".modelreasoning",
+    "ModelReasoningTypedDict": ".modelreasoning",
     "ModelResponse": ".modelresponse",
     "ModelResponseTypedDict": ".modelresponse",
     "ModelsCountResponse": ".modelscountresponse",
@@ -5908,6 +6190,9 @@
     "PublicPricing": ".publicpricing",
     "PublicPricingTypedDict": ".publicpricing",
     "Quantization": ".quantization",
+    "RangeCapability": ".rangecapability",
+    "RangeCapabilityType": ".rangecapability",
+    "RangeCapabilityTypedDict": ".rangecapability",
     "RankingsDailyItem": ".rankingsdailyitem",
     "RankingsDailyItemTypedDict": ".rankingsdailyitem",
     "RankingsDailyMeta": ".rankingsdailymeta",
@@ -6127,6 +6412,24 @@
     "Truncation": ".truncation",
     "UnauthorizedResponseErrorData": ".unauthorizedresponseerrordata",
     "UnauthorizedResponseErrorDataTypedDict": ".unauthorizedresponseerrordata",
+    "UnifiedBenchmarkPricing": ".unifiedbenchmarkpricing",
+    "UnifiedBenchmarkPricingTypedDict": ".unifiedbenchmarkpricing",
+    "UnifiedBenchmarksAAItem": ".unifiedbenchmarksaaitem",
+    "UnifiedBenchmarksAAItemSource": ".unifiedbenchmarksaaitem",
+    "UnifiedBenchmarksAAItemTypedDict": ".unifiedbenchmarksaaitem",
+    "TournamentStats": ".unifiedbenchmarksdaitem",
+    "TournamentStatsTypedDict": ".unifiedbenchmarksdaitem",
+    "UnifiedBenchmarksDAItem": ".unifiedbenchmarksdaitem",
+    "UnifiedBenchmarksDAItemSource": ".unifiedbenchmarksdaitem",
+    "UnifiedBenchmarksDAItemTypedDict": ".unifiedbenchmarksdaitem",
+    "UnifiedBenchmarksMeta": ".unifiedbenchmarksmeta",
+    "UnifiedBenchmarksMetaSource": ".unifiedbenchmarksmeta",
+    "UnifiedBenchmarksMetaTypedDict": ".unifiedbenchmarksmeta",
+    "UnifiedBenchmarksMetaVersion": ".unifiedbenchmarksmeta",
+    "UnifiedBenchmarksResponse": ".unifiedbenchmarksresponse",
+    "UnifiedBenchmarksResponseData": ".unifiedbenchmarksresponse",
+    "UnifiedBenchmarksResponseDataTypedDict": ".unifiedbenchmarksresponse",
+    "UnifiedBenchmarksResponseTypedDict": ".unifiedbenchmarksresponse",
     "UnprocessableEntityResponseErrorData": ".unprocessableentityresponseerrordata",
     "UnprocessableEntityResponseErrorDataTypedDict": ".unprocessableentityresponseerrordata",
     "UpdateBYOKKeyRequest": ".updatebyokkeyrequest",
@@ -6160,13 +6463,13 @@
     "UsageCostDetails": ".usage",
     "UsageCostDetailsTypedDict": ".usage",
     "UsageTypedDict": ".usage",
-    "AspectRatio": ".videogenerationrequest",
-    "Options": ".videogenerationrequest",
-    "OptionsTypedDict": ".videogenerationrequest",
-    "Resolution": ".videogenerationrequest",
     "VideoGenerationRequest": ".videogenerationrequest",
+    "VideoGenerationRequestAspectRatio": ".videogenerationrequest",
+    "VideoGenerationRequestOptions": ".videogenerationrequest",
+    "VideoGenerationRequestOptionsTypedDict": ".videogenerationrequest",
     "VideoGenerationRequestProvider": ".videogenerationrequest",
     "VideoGenerationRequestProviderTypedDict": ".videogenerationrequest",
+    "VideoGenerationRequestResolution": ".videogenerationrequest",
     "VideoGenerationRequestTypedDict": ".videogenerationrequest",
     "VideoGenerationResponse": ".videogenerationresponse",
     "VideoGenerationResponseStatus": ".videogenerationresponse",
diff --git a/src/openrouter/components/advisorreasoning.py b/src/openrouter/components/advisorreasoning.py
index 73763465..a2ab4386 100644
--- a/src/openrouter/components/advisorreasoning.py
+++ b/src/openrouter/components/advisorreasoning.py
@@ -10,6 +10,7 @@
 
 AdvisorReasoningEffort = Union[
     Literal[
+        "max",
         "xhigh",
         "high",
         "medium",
diff --git a/src/openrouter/components/anthropicadvisormessageusageiteration.py b/src/openrouter/components/anthropicadvisormessageusageiteration.py
new file mode 100644
index 00000000..86b0175b
--- /dev/null
+++ b/src/openrouter/components/anthropicadvisormessageusageiteration.py
@@ -0,0 +1,82 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .anthropiciterationcachecreation import (
+    AnthropicIterationCacheCreation,
+    AnthropicIterationCacheCreationTypedDict,
+)
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+)
+from pydantic import model_serializer
+from typing import Literal, Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+AnthropicAdvisorMessageUsageIterationType = Literal["advisor_message",]
+
+
+class AnthropicAdvisorMessageUsageIterationTypedDict(TypedDict):
+    model: str
+    type: AnthropicAdvisorMessageUsageIterationType
+    cache_creation: NotRequired[Nullable[AnthropicIterationCacheCreationTypedDict]]
+    cache_creation_input_tokens: NotRequired[int]
+    cache_read_input_tokens: NotRequired[int]
+    input_tokens: NotRequired[int]
+    output_tokens: NotRequired[int]
+
+
+class AnthropicAdvisorMessageUsageIteration(BaseModel):
+    model: str
+
+    type: AnthropicAdvisorMessageUsageIterationType
+
+    cache_creation: OptionalNullable[AnthropicIterationCacheCreation] = UNSET
+
+    cache_creation_input_tokens: Optional[int] = None
+
+    cache_read_input_tokens: Optional[int] = None
+
+    input_tokens: Optional[int] = None
+
+    output_tokens: Optional[int] = None
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "cache_creation",
+            "cache_creation_input_tokens",
+            "cache_read_input_tokens",
+            "input_tokens",
+            "output_tokens",
+        ]
+        nullable_fields = ["cache_creation"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/anthropiccompactionusageiteration.py b/src/openrouter/components/anthropiccompactionusageiteration.py
new file mode 100644
index 00000000..5b00555a
--- /dev/null
+++ b/src/openrouter/components/anthropiccompactionusageiteration.py
@@ -0,0 +1,79 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .anthropiciterationcachecreation import (
+    AnthropicIterationCacheCreation,
+    AnthropicIterationCacheCreationTypedDict,
+)
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+)
+from pydantic import model_serializer
+from typing import Literal, Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+AnthropicCompactionUsageIterationType = Literal["compaction",]
+
+
+class AnthropicCompactionUsageIterationTypedDict(TypedDict):
+    type: AnthropicCompactionUsageIterationType
+    cache_creation: NotRequired[Nullable[AnthropicIterationCacheCreationTypedDict]]
+    cache_creation_input_tokens: NotRequired[int]
+    cache_read_input_tokens: NotRequired[int]
+    input_tokens: NotRequired[int]
+    output_tokens: NotRequired[int]
+
+
+class AnthropicCompactionUsageIteration(BaseModel):
+    type: AnthropicCompactionUsageIterationType
+
+    cache_creation: OptionalNullable[AnthropicIterationCacheCreation] = UNSET
+
+    cache_creation_input_tokens: Optional[int] = None
+
+    cache_read_input_tokens: Optional[int] = None
+
+    input_tokens: Optional[int] = None
+
+    output_tokens: Optional[int] = None
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "cache_creation",
+            "cache_creation_input_tokens",
+            "cache_read_input_tokens",
+            "input_tokens",
+            "output_tokens",
+        ]
+        nullable_fields = ["cache_creation"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/anthropiciterationcachecreation.py b/src/openrouter/components/anthropiciterationcachecreation.py
new file mode 100644
index 00000000..94477718
--- /dev/null
+++ b/src/openrouter/components/anthropiciterationcachecreation.py
@@ -0,0 +1,17 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel
+from typing import Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+class AnthropicIterationCacheCreationTypedDict(TypedDict):
+    ephemeral_1h_input_tokens: NotRequired[int]
+    ephemeral_5m_input_tokens: NotRequired[int]
+
+
+class AnthropicIterationCacheCreation(BaseModel):
+    ephemeral_1h_input_tokens: Optional[int] = None
+
+    ephemeral_5m_input_tokens: Optional[int] = None
diff --git a/src/openrouter/components/anthropicmessageusageiteration.py b/src/openrouter/components/anthropicmessageusageiteration.py
new file mode 100644
index 00000000..0c76c289
--- /dev/null
+++ b/src/openrouter/components/anthropicmessageusageiteration.py
@@ -0,0 +1,83 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .anthropiciterationcachecreation import (
+    AnthropicIterationCacheCreation,
+    AnthropicIterationCacheCreationTypedDict,
+)
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+)
+from pydantic import model_serializer
+from typing import Literal, Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+AnthropicMessageUsageIterationType = Literal["message",]
+
+
+class AnthropicMessageUsageIterationTypedDict(TypedDict):
+    type: AnthropicMessageUsageIterationType
+    cache_creation: NotRequired[Nullable[AnthropicIterationCacheCreationTypedDict]]
+    cache_creation_input_tokens: NotRequired[int]
+    cache_read_input_tokens: NotRequired[int]
+    input_tokens: NotRequired[int]
+    output_tokens: NotRequired[int]
+    model: NotRequired[str]
+
+
+class AnthropicMessageUsageIteration(BaseModel):
+    type: AnthropicMessageUsageIterationType
+
+    cache_creation: OptionalNullable[AnthropicIterationCacheCreation] = UNSET
+
+    cache_creation_input_tokens: Optional[int] = None
+
+    cache_read_input_tokens: Optional[int] = None
+
+    input_tokens: Optional[int] = None
+
+    output_tokens: Optional[int] = None
+
+    model: Optional[str] = None
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "cache_creation",
+            "cache_creation_input_tokens",
+            "cache_read_input_tokens",
+            "input_tokens",
+            "output_tokens",
+            "model",
+        ]
+        nullable_fields = ["cache_creation"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/anthropicspeed.py b/src/openrouter/components/anthropicspeed.py
new file mode 100644
index 00000000..4f9c2bc7
--- /dev/null
+++ b/src/openrouter/components/anthropicspeed.py
@@ -0,0 +1,14 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import UnrecognizedStr
+from typing import Literal, Union
+
+
+AnthropicSpeed = Union[
+    Literal[
+        "fast",
+        "standard",
+    ],
+    UnrecognizedStr,
+]
diff --git a/src/openrouter/components/anthropicunknownusageiteration.py b/src/openrouter/components/anthropicunknownusageiteration.py
new file mode 100644
index 00000000..5bbd2e0f
--- /dev/null
+++ b/src/openrouter/components/anthropicunknownusageiteration.py
@@ -0,0 +1,76 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .anthropiciterationcachecreation import (
+    AnthropicIterationCacheCreation,
+    AnthropicIterationCacheCreationTypedDict,
+)
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+)
+from pydantic import model_serializer
+from typing import Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+class AnthropicUnknownUsageIterationTypedDict(TypedDict):
+    type: str
+    cache_creation: NotRequired[Nullable[AnthropicIterationCacheCreationTypedDict]]
+    cache_creation_input_tokens: NotRequired[int]
+    cache_read_input_tokens: NotRequired[int]
+    input_tokens: NotRequired[int]
+    output_tokens: NotRequired[int]
+
+
+class AnthropicUnknownUsageIteration(BaseModel):
+    type: str
+
+    cache_creation: OptionalNullable[AnthropicIterationCacheCreation] = UNSET
+
+    cache_creation_input_tokens: Optional[int] = None
+
+    cache_read_input_tokens: Optional[int] = None
+
+    input_tokens: Optional[int] = None
+
+    output_tokens: Optional[int] = None
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "cache_creation",
+            "cache_creation_input_tokens",
+            "cache_read_input_tokens",
+            "input_tokens",
+            "output_tokens",
+        ]
+        nullable_fields = ["cache_creation"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/anthropicusageiteration.py b/src/openrouter/components/anthropicusageiteration.py
new file mode 100644
index 00000000..a984e7a5
--- /dev/null
+++ b/src/openrouter/components/anthropicusageiteration.py
@@ -0,0 +1,43 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .anthropicadvisormessageusageiteration import (
+    AnthropicAdvisorMessageUsageIteration,
+    AnthropicAdvisorMessageUsageIterationTypedDict,
+)
+from .anthropiccompactionusageiteration import (
+    AnthropicCompactionUsageIteration,
+    AnthropicCompactionUsageIterationTypedDict,
+)
+from .anthropicmessageusageiteration import (
+    AnthropicMessageUsageIteration,
+    AnthropicMessageUsageIterationTypedDict,
+)
+from .anthropicunknownusageiteration import (
+    AnthropicUnknownUsageIteration,
+    AnthropicUnknownUsageIterationTypedDict,
+)
+from typing import Union
+from typing_extensions import TypeAliasType
+
+
+AnthropicUsageIterationTypedDict = TypeAliasType(
+    "AnthropicUsageIterationTypedDict",
+    Union[
+        AnthropicCompactionUsageIterationTypedDict,
+        AnthropicUnknownUsageIterationTypedDict,
+        AnthropicMessageUsageIterationTypedDict,
+        AnthropicAdvisorMessageUsageIterationTypedDict,
+    ],
+)
+
+
+AnthropicUsageIteration = TypeAliasType(
+    "AnthropicUsageIteration",
+    Union[
+        AnthropicCompactionUsageIteration,
+        AnthropicUnknownUsageIteration,
+        AnthropicMessageUsageIteration,
+        AnthropicAdvisorMessageUsageIteration,
+    ],
+)
diff --git a/src/openrouter/components/benchmarksaameta.py b/src/openrouter/components/benchmarksaameta.py
deleted file mode 100644
index 9d751f4a..00000000
--- a/src/openrouter/components/benchmarksaameta.py
+++ /dev/null
@@ -1,53 +0,0 @@
-"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
-
-from __future__ import annotations
-from openrouter.types import BaseModel
-from typing import Literal
-from typing_extensions import TypedDict
-
-
-BenchmarksAAMetaSource = Literal["artificial-analysis",]
-r"""Data source identifier."""
-
-
-BenchmarksAAMetaSourceURL = Literal["https://artificialanalysis.ai",]
-r"""URL of the upstream data source."""
-
-
-BenchmarksAAMetaVersion = Literal["v1",]
-r"""Dataset version."""
-
-
-class BenchmarksAAMetaTypedDict(TypedDict):
-    as_of: str
-    r"""ISO-8601 timestamp of when this data was last updated."""
-    citation: str
-    r"""Required attribution when republishing this data."""
-    model_count: int
-    r"""Number of unique models in the response."""
-    source: BenchmarksAAMetaSource
-    r"""Data source identifier."""
-    source_url: BenchmarksAAMetaSourceURL
-    r"""URL of the upstream data source."""
-    version: BenchmarksAAMetaVersion
-    r"""Dataset version."""
-
-
-class BenchmarksAAMeta(BaseModel):
-    as_of: str
-    r"""ISO-8601 timestamp of when this data was last updated."""
-
-    citation: str
-    r"""Required attribution when republishing this data."""
-
-    model_count: int
-    r"""Number of unique models in the response."""
-
-    source: BenchmarksAAMetaSource
-    r"""Data source identifier."""
-
-    source_url: BenchmarksAAMetaSourceURL
-    r"""URL of the upstream data source."""
-
-    version: BenchmarksAAMetaVersion
-    r"""Dataset version."""
diff --git a/src/openrouter/components/benchmarksaaresponse.py b/src/openrouter/components/benchmarksaaresponse.py
deleted file mode 100644
index 787ae1ca..00000000
--- a/src/openrouter/components/benchmarksaaresponse.py
+++ /dev/null
@@ -1,19 +0,0 @@
-"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
-
-from __future__ import annotations
-from .benchmarksaaitem import BenchmarksAAItem, BenchmarksAAItemTypedDict
-from .benchmarksaameta import BenchmarksAAMeta, BenchmarksAAMetaTypedDict
-from openrouter.types import BaseModel
-from typing import List
-from typing_extensions import TypedDict
-
-
-class BenchmarksAAResponseTypedDict(TypedDict):
-    data: List[BenchmarksAAItemTypedDict]
-    meta: BenchmarksAAMetaTypedDict
-
-
-class BenchmarksAAResponse(BaseModel):
-    data: List[BenchmarksAAItem]
-
-    meta: BenchmarksAAMeta
diff --git a/src/openrouter/components/benchmarksdameta.py b/src/openrouter/components/benchmarksdameta.py
deleted file mode 100644
index 0ca3550d..00000000
--- a/src/openrouter/components/benchmarksdameta.py
+++ /dev/null
@@ -1,118 +0,0 @@
-"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
-
-from __future__ import annotations
-from openrouter.types import BaseModel, Nullable, UNSET_SENTINEL
-from pydantic import model_serializer
-from typing import Literal
-from typing_extensions import TypedDict
-
-
-class EloBoundsTypedDict(TypedDict):
-    r"""ELO range across all returned models for normalization."""
-
-    max: float
-    r"""Maximum ELO in the result set."""
-    min: float
-    r"""Minimum ELO in the result set."""
-
-
-class EloBounds(BaseModel):
-    r"""ELO range across all returned models for normalization."""
-
-    max: float
-    r"""Maximum ELO in the result set."""
-
-    min: float
-    r"""Minimum ELO in the result set."""
-
-
-BenchmarksDAMetaSource = Literal["design-arena",]
-r"""Data source identifier."""
-
-
-BenchmarksDAMetaSourceURL = Literal["https://www.designarena.ai",]
-r"""URL of the upstream data source."""
-
-
-BenchmarksDAMetaVersion = Literal["v1",]
-r"""Dataset version."""
-
-
-class BenchmarksDAMetaTypedDict(TypedDict):
-    arena: str
-    r"""The arena filter applied."""
-    as_of: str
-    r"""ISO-8601 timestamp of when this data was generated."""
-    category: Nullable[str]
-    r"""The category filter applied, or null if showing all."""
-    citation: str
-    r"""Required attribution when republishing this data."""
-    elo_bounds: EloBoundsTypedDict
-    r"""ELO range across all returned models for normalization."""
-    model_count: int
-    r"""Number of unique models in the response."""
-    source: BenchmarksDAMetaSource
-    r"""Data source identifier."""
-    source_url: BenchmarksDAMetaSourceURL
-    r"""URL of the upstream data source."""
-    version: BenchmarksDAMetaVersion
-    r"""Dataset version."""
-
-
-class BenchmarksDAMeta(BaseModel):
-    arena: str
-    r"""The arena filter applied."""
-
-    as_of: str
-    r"""ISO-8601 timestamp of when this data was generated."""
-
-    category: Nullable[str]
-    r"""The category filter applied, or null if showing all."""
-
-    citation: str
-    r"""Required attribution when republishing this data."""
-
-    elo_bounds: EloBounds
-    r"""ELO range across all returned models for normalization."""
-
-    model_count: int
-    r"""Number of unique models in the response."""
-
-    source: BenchmarksDAMetaSource
-    r"""Data source identifier."""
-
-    source_url: BenchmarksDAMetaSourceURL
-    r"""URL of the upstream data source."""
-
-    version: BenchmarksDAMetaVersion
-    r"""Dataset version."""
-
-    @model_serializer(mode="wrap")
-    def serialize_model(self, handler):
-        optional_fields = []
-        nullable_fields = ["category"]
-        null_default_fields = []
-
-        serialized = handler(self)
-
-        m = {}
-
-        for n, f in type(self).model_fields.items():
-            k = f.alias or n
-            val = serialized.get(k)
-            serialized.pop(k, None)
-
-            optional_nullable = k in optional_fields and k in nullable_fields
-            is_set = (
-                self.__pydantic_fields_set__.intersection({n})
-                or k in null_default_fields
-            )  # pylint: disable=no-member
-
-            if val is not None and val != UNSET_SENTINEL:
-                m[k] = val
-            elif val != UNSET_SENTINEL and (
-                not k in optional_fields or (optional_nullable and is_set)
-            ):
-                m[k] = val
-
-        return m
diff --git a/src/openrouter/components/benchmarksdaresponse.py b/src/openrouter/components/benchmarksdaresponse.py
deleted file mode 100644
index 7588fc52..00000000
--- a/src/openrouter/components/benchmarksdaresponse.py
+++ /dev/null
@@ -1,19 +0,0 @@
-"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
-
-from __future__ import annotations
-from .benchmarksdaitem import BenchmarksDAItem, BenchmarksDAItemTypedDict
-from .benchmarksdameta import BenchmarksDAMeta, BenchmarksDAMetaTypedDict
-from openrouter.types import BaseModel
-from typing import List
-from typing_extensions import TypedDict
-
-
-class BenchmarksDAResponseTypedDict(TypedDict):
-    data: List[BenchmarksDAItemTypedDict]
-    meta: BenchmarksDAMetaTypedDict
-
-
-class BenchmarksDAResponse(BaseModel):
-    data: List[BenchmarksDAItem]
-
-    meta: BenchmarksDAMeta
diff --git a/src/openrouter/components/booleancapability.py b/src/openrouter/components/booleancapability.py
new file mode 100644
index 00000000..75d5ed89
--- /dev/null
+++ b/src/openrouter/components/booleancapability.py
@@ -0,0 +1,21 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel
+from typing import Literal
+from typing_extensions import TypedDict
+
+
+BooleanCapabilityType = Literal["boolean",]
+
+
+class BooleanCapabilityTypedDict(TypedDict):
+    r"""A supported-or-not flag. Present means the parameter is accepted."""
+
+    type: BooleanCapabilityType
+
+
+class BooleanCapability(BaseModel):
+    r"""A supported-or-not flag. Present means the parameter is accepted."""
+
+    type: BooleanCapabilityType
diff --git a/src/openrouter/components/capabilitydescriptor.py b/src/openrouter/components/capabilitydescriptor.py
new file mode 100644
index 00000000..3b40c65b
--- /dev/null
+++ b/src/openrouter/components/capabilitydescriptor.py
@@ -0,0 +1,30 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .booleancapability import BooleanCapability, BooleanCapabilityTypedDict
+from .enumcapability import EnumCapability, EnumCapabilityTypedDict
+from .rangecapability import RangeCapability, RangeCapabilityTypedDict
+from openrouter.utils import get_discriminator
+from pydantic import Discriminator, Tag
+from typing import Union
+from typing_extensions import Annotated, TypeAliasType
+
+
+CapabilityDescriptorTypedDict = TypeAliasType(
+    "CapabilityDescriptorTypedDict",
+    Union[
+        BooleanCapabilityTypedDict, EnumCapabilityTypedDict, RangeCapabilityTypedDict
+    ],
+)
+r"""A typed descriptor for one supported request parameter."""
+
+
+CapabilityDescriptor = Annotated[
+    Union[
+        Annotated[EnumCapability, Tag("enum")],
+        Annotated[RangeCapability, Tag("range")],
+        Annotated[BooleanCapability, Tag("boolean")],
+    ],
+    Discriminator(lambda m: get_discriminator(m, "type", "type")),
+]
+r"""A typed descriptor for one supported request parameter."""
diff --git a/src/openrouter/components/chatrequest.py b/src/openrouter/components/chatrequest.py
index f90c2905..f60f367c 100644
--- a/src/openrouter/components/chatrequest.py
+++ b/src/openrouter/components/chatrequest.py
@@ -106,6 +106,7 @@
 
 ChatRequestEffort = Union[
     Literal[
+        "max",
         "xhigh",
         "high",
         "medium",
@@ -172,6 +173,7 @@ def serialize_model(self, handler):
 
 ChatRequestReasoningEffort = Union[
     Literal[
+        "max",
         "xhigh",
         "high",
         "medium",
diff --git a/src/openrouter/components/chatstreamchunk.py b/src/openrouter/components/chatstreamchunk.py
index 52c37761..33d4daba 100644
--- a/src/openrouter/components/chatstreamchunk.py
+++ b/src/openrouter/components/chatstreamchunk.py
@@ -16,7 +16,7 @@
 from typing_extensions import NotRequired, TypedDict
 
 
-class ErrorTypedDict(TypedDict):
+class ChatStreamChunkErrorTypedDict(TypedDict):
     r"""Error information"""
 
     code: int
@@ -25,7 +25,7 @@ class ErrorTypedDict(TypedDict):
     r"""Error message"""
 
 
-class Error(BaseModel):
+class ChatStreamChunkError(BaseModel):
     r"""Error information"""
 
     code: int
@@ -50,7 +50,7 @@ class ChatStreamChunkTypedDict(TypedDict):
     model: str
     r"""Model used for completion"""
     object: ChatStreamChunkObject
-    error: NotRequired[ErrorTypedDict]
+    error: NotRequired[ChatStreamChunkErrorTypedDict]
     r"""Error information"""
     openrouter_metadata: NotRequired[OpenRouterMetadataTypedDict]
     service_tier: NotRequired[Nullable[str]]
@@ -78,7 +78,7 @@ class ChatStreamChunk(BaseModel):
 
     object: ChatStreamChunkObject
 
-    error: Optional[Error] = None
+    error: Optional[ChatStreamChunkError] = None
     r"""Error information"""
 
     openrouter_metadata: Optional[OpenRouterMetadata] = None
diff --git a/src/openrouter/components/chatusage.py b/src/openrouter/components/chatusage.py
index 3a7357d8..8eb123a2 100644
--- a/src/openrouter/components/chatusage.py
+++ b/src/openrouter/components/chatusage.py
@@ -14,7 +14,7 @@
 from typing_extensions import NotRequired, TypedDict
 
 
-class CompletionTokensDetailsTypedDict(TypedDict):
+class ChatUsageCompletionTokensDetailsTypedDict(TypedDict):
     r"""Detailed completion token usage"""
 
     accepted_prediction_tokens: NotRequired[Nullable[int]]
@@ -27,7 +27,7 @@ class CompletionTokensDetailsTypedDict(TypedDict):
     r"""Rejected prediction tokens"""
 
 
-class CompletionTokensDetails(BaseModel):
+class ChatUsageCompletionTokensDetails(BaseModel):
     r"""Detailed completion token usage"""
 
     accepted_prediction_tokens: OptionalNullable[int] = UNSET
@@ -83,7 +83,7 @@ def serialize_model(self, handler):
         return m
 
 
-class PromptTokensDetailsTypedDict(TypedDict):
+class ChatUsagePromptTokensDetailsTypedDict(TypedDict):
     r"""Detailed prompt token usage"""
 
     audio_tokens: NotRequired[int]
@@ -96,7 +96,7 @@ class PromptTokensDetailsTypedDict(TypedDict):
     r"""Video input tokens"""
 
 
-class PromptTokensDetails(BaseModel):
+class ChatUsagePromptTokensDetails(BaseModel):
     r"""Detailed prompt token usage"""
 
     audio_tokens: Optional[int] = None
@@ -112,6 +112,68 @@ class PromptTokensDetails(BaseModel):
     r"""Video input tokens"""
 
 
+class ServerToolUseDetailsTypedDict(TypedDict):
+    r"""Usage for server-side tool execution (e.g., web search)"""
+
+    tool_calls_executed: NotRequired[Nullable[int]]
+    r"""Number of OpenRouter server tool calls that executed and produced a result"""
+    tool_calls_requested: NotRequired[Nullable[int]]
+    r"""Total number of OpenRouter server-orchestrated tool calls the model requested, across all tool types. Provider-native tools (e.g. native web search) are not counted here."""
+    web_search_requests: NotRequired[Nullable[int]]
+    r"""Number of web searches performed by server-side tools. For server-orchestrated tool calls a web search is also counted in tool_calls_requested; provider-native web search may report web_search_requests only. Do not sum the two."""
+
+
+class ServerToolUseDetails(BaseModel):
+    r"""Usage for server-side tool execution (e.g., web search)"""
+
+    tool_calls_executed: OptionalNullable[int] = UNSET
+    r"""Number of OpenRouter server tool calls that executed and produced a result"""
+
+    tool_calls_requested: OptionalNullable[int] = UNSET
+    r"""Total number of OpenRouter server-orchestrated tool calls the model requested, across all tool types. Provider-native tools (e.g. native web search) are not counted here."""
+
+    web_search_requests: OptionalNullable[int] = UNSET
+    r"""Number of web searches performed by server-side tools. For server-orchestrated tool calls a web search is also counted in tool_calls_requested; provider-native web search may report web_search_requests only. Do not sum the two."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "tool_calls_executed",
+            "tool_calls_requested",
+            "web_search_requests",
+        ]
+        nullable_fields = [
+            "tool_calls_executed",
+            "tool_calls_requested",
+            "web_search_requests",
+        ]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
+
 class ChatUsageTypedDict(TypedDict):
     r"""Token usage statistics"""
 
@@ -121,7 +183,9 @@ class ChatUsageTypedDict(TypedDict):
     r"""Number of tokens in the prompt"""
     total_tokens: int
     r"""Total number of tokens"""
-    completion_tokens_details: NotRequired[Nullable[CompletionTokensDetailsTypedDict]]
+    completion_tokens_details: NotRequired[
+        Nullable[ChatUsageCompletionTokensDetailsTypedDict]
+    ]
     r"""Detailed completion token usage"""
     cost: NotRequired[Nullable[float]]
     r"""Cost of the completion"""
@@ -129,8 +193,10 @@ class ChatUsageTypedDict(TypedDict):
     r"""Breakdown of upstream inference costs"""
     is_byok: NotRequired[bool]
     r"""Whether a request was made using a Bring Your Own Key configuration"""
-    prompt_tokens_details: NotRequired[Nullable[PromptTokensDetailsTypedDict]]
+    prompt_tokens_details: NotRequired[Nullable[ChatUsagePromptTokensDetailsTypedDict]]
     r"""Detailed prompt token usage"""
+    server_tool_use_details: NotRequired[Nullable[ServerToolUseDetailsTypedDict]]
+    r"""Usage for server-side tool execution (e.g., web search)"""
 
 
 class ChatUsage(BaseModel):
@@ -145,7 +211,9 @@ class ChatUsage(BaseModel):
     total_tokens: int
     r"""Total number of tokens"""
 
-    completion_tokens_details: OptionalNullable[CompletionTokensDetails] = UNSET
+    completion_tokens_details: OptionalNullable[ChatUsageCompletionTokensDetails] = (
+        UNSET
+    )
     r"""Detailed completion token usage"""
 
     cost: OptionalNullable[float] = UNSET
@@ -157,9 +225,12 @@ class ChatUsage(BaseModel):
     is_byok: Optional[bool] = None
     r"""Whether a request was made using a Bring Your Own Key configuration"""
 
-    prompt_tokens_details: OptionalNullable[PromptTokensDetails] = UNSET
+    prompt_tokens_details: OptionalNullable[ChatUsagePromptTokensDetails] = UNSET
     r"""Detailed prompt token usage"""
 
+    server_tool_use_details: OptionalNullable[ServerToolUseDetails] = UNSET
+    r"""Usage for server-side tool execution (e.g., web search)"""
+
     @model_serializer(mode="wrap")
     def serialize_model(self, handler):
         optional_fields = [
@@ -168,12 +239,14 @@ def serialize_model(self, handler):
             "cost_details",
             "is_byok",
             "prompt_tokens_details",
+            "server_tool_use_details",
         ]
         nullable_fields = [
             "completion_tokens_details",
             "cost",
             "cost_details",
             "prompt_tokens_details",
+            "server_tool_use_details",
         ]
         null_default_fields = []
 
diff --git a/src/openrouter/components/debugevent.py b/src/openrouter/components/debugevent.py
new file mode 100644
index 00000000..e163680e
--- /dev/null
+++ b/src/openrouter/components/debugevent.py
@@ -0,0 +1,65 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel, Nullable, UnrecognizedStr
+from openrouter.utils import validate_open_enum
+from pydantic.functional_validators import PlainValidator
+from typing import Any, Dict, Literal, Optional, Union
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+Event = Union[
+    Literal[
+        "adapter_request",
+        "upstream_headers_received",
+        "first_token_received",
+        "upstream_body_ended",
+    ],
+    UnrecognizedStr,
+]
+
+
+class TimingsTypedDict(TypedDict):
+    epoch_ms: int
+    event: Event
+    start_ms: int
+
+
+class Timings(BaseModel):
+    epoch_ms: int
+
+    event: Annotated[Event, PlainValidator(validate_open_enum(False))]
+
+    start_ms: int
+
+
+class DebugTypedDict(TypedDict):
+    echo_upstream_body: NotRequired[Dict[str, Nullable[Any]]]
+    timings: NotRequired[TimingsTypedDict]
+
+
+class Debug(BaseModel):
+    echo_upstream_body: Optional[Dict[str, Nullable[Any]]] = None
+
+    timings: Optional[Timings] = None
+
+
+DebugEventType = Literal["response.debug",]
+
+
+class DebugEventTypedDict(TypedDict):
+    r"""Debug event emitted when debug.echo_upstream_body is true. Contains the transformed upstream request body or timing milestones."""
+
+    debug: DebugTypedDict
+    sequence_number: int
+    type: DebugEventType
+
+
+class DebugEvent(BaseModel):
+    r"""Debug event emitted when debug.echo_upstream_body is true. Contains the transformed upstream request body or timing milestones."""
+
+    debug: Debug
+
+    sequence_number: int
+
+    type: DebugEventType
diff --git a/src/openrouter/components/enumcapability.py b/src/openrouter/components/enumcapability.py
new file mode 100644
index 00000000..468dba81
--- /dev/null
+++ b/src/openrouter/components/enumcapability.py
@@ -0,0 +1,24 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel
+from typing import List, Literal
+from typing_extensions import TypedDict
+
+
+EnumCapabilityType = Literal["enum",]
+
+
+class EnumCapabilityTypedDict(TypedDict):
+    r"""A parameter that accepts one of a discrete set of string values."""
+
+    type: EnumCapabilityType
+    values: List[str]
+
+
+class EnumCapability(BaseModel):
+    r"""A parameter that accepts one of a discrete set of string values."""
+
+    type: EnumCapabilityType
+
+    values: List[str]
diff --git a/src/openrouter/components/fusionservertoolconfig.py b/src/openrouter/components/fusionservertoolconfig.py
index 4eae6cf0..a9631f6d 100644
--- a/src/openrouter/components/fusionservertoolconfig.py
+++ b/src/openrouter/components/fusionservertoolconfig.py
@@ -1,6 +1,10 @@
 """Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
 
 from __future__ import annotations
+from .anthropiccachecontroldirective import (
+    AnthropicCacheControlDirective,
+    AnthropicCacheControlDirectiveTypedDict,
+)
 from openrouter.types import BaseModel, Nullable, UnrecognizedStr
 from openrouter.utils import validate_open_enum
 from pydantic.functional_validators import PlainValidator
@@ -10,6 +14,7 @@
 
 FusionServerToolConfigEffort = Union[
     Literal[
+        "max",
         "xhigh",
         "high",
         "medium",
@@ -64,6 +69,8 @@ class FusionServerToolConfigTypedDict(TypedDict):
 
     analysis_models: NotRequired[List[str]]
     r"""Slugs of models to run in parallel as the analysis panel. Each model receives the user prompt with openrouter:web_search and openrouter:web_fetch enabled, then a judge model summarizes the collective output into structured analysis JSON. Capped at 8 models to bound cost amplification. Defaults to the Quality preset from /labs/fusion."""
+    cache_control: NotRequired[AnthropicCacheControlDirectiveTypedDict]
+    r"""Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models."""
     max_completion_tokens: NotRequired[int]
     r"""Maximum number of output tokens (including reasoning tokens) each panelist and the judge model may produce per inner call. Controls the total output budget so reasoning-heavy models like GPT-5.5 do not exhaust their token allowance before producing visible text. When omitted, the provider's default applies."""
     max_tool_calls: NotRequired[int]
@@ -84,6 +91,9 @@ class FusionServerToolConfig(BaseModel):
     analysis_models: Optional[List[str]] = None
     r"""Slugs of models to run in parallel as the analysis panel. Each model receives the user prompt with openrouter:web_search and openrouter:web_fetch enabled, then a judge model summarizes the collective output into structured analysis JSON. Capped at 8 models to bound cost amplification. Defaults to the Quality preset from /labs/fusion."""
 
+    cache_control: Optional[AnthropicCacheControlDirective] = None
+    r"""Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models."""
+
     max_completion_tokens: Optional[int] = None
     r"""Maximum number of output tokens (including reasoning tokens) each panelist and the judge model may produce per inner call. Controls the total output budget so reasoning-heavy models like GPT-5.5 do not exhaust their token allowance before producing visible text. When omitted, the provider's default applies."""
 
diff --git a/src/openrouter/components/imageendpoint.py b/src/openrouter/components/imageendpoint.py
new file mode 100644
index 00000000..8d392046
--- /dev/null
+++ b/src/openrouter/components/imageendpoint.py
@@ -0,0 +1,81 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .capabilitydescriptor import CapabilityDescriptor, CapabilityDescriptorTypedDict
+from .imagepricingentry import ImagePricingEntry, ImagePricingEntryTypedDict
+from openrouter.types import BaseModel, Nullable, UNSET_SENTINEL
+from pydantic import model_serializer
+from typing import Dict, List
+from typing_extensions import TypedDict
+
+
+class ImageEndpointTypedDict(TypedDict):
+    r"""An endpoint that serves a given image model."""
+
+    allowed_passthrough_parameters: List[str]
+    r"""Provider-specific options accepted under provider.options[provider_slug]."""
+    pricing: List[ImagePricingEntryTypedDict]
+    r"""Billable pricing lines for this endpoint."""
+    provider_name: str
+    r"""Provider display name"""
+    provider_slug: str
+    r"""Provider slug"""
+    provider_tag: Nullable[str]
+    r"""Provider tag for request-side selection"""
+    supported_parameters: Dict[str, CapabilityDescriptorTypedDict]
+    supports_streaming: bool
+    r"""Whether this endpoint supports native SSE streaming (`stream: true` in the request)."""
+
+
+class ImageEndpoint(BaseModel):
+    r"""An endpoint that serves a given image model."""
+
+    allowed_passthrough_parameters: List[str]
+    r"""Provider-specific options accepted under provider.options[provider_slug]."""
+
+    pricing: List[ImagePricingEntry]
+    r"""Billable pricing lines for this endpoint."""
+
+    provider_name: str
+    r"""Provider display name"""
+
+    provider_slug: str
+    r"""Provider slug"""
+
+    provider_tag: Nullable[str]
+    r"""Provider tag for request-side selection"""
+
+    supported_parameters: Dict[str, CapabilityDescriptor]
+
+    supports_streaming: bool
+    r"""Whether this endpoint supports native SSE streaming (`stream: true` in the request)."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = []
+        nullable_fields = ["provider_tag"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/imagegencompletedevent.py b/src/openrouter/components/imagegencompletedevent.py
new file mode 100644
index 00000000..e5907de8
--- /dev/null
+++ b/src/openrouter/components/imagegencompletedevent.py
@@ -0,0 +1,40 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .imagegenerationusage import ImageGenerationUsage, ImageGenerationUsageTypedDict
+from openrouter.types import BaseModel
+from typing import Literal, Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+ImageGenCompletedEventType = Literal["image_generation.completed",]
+r"""The event type"""
+
+
+class ImageGenCompletedEventTypedDict(TypedDict):
+    r"""Emitted when generation completes and the final image is available"""
+
+    b64_json: str
+    r"""Base64-encoded final image data"""
+    created: int
+    r"""Unix timestamp (seconds) when the image was generated"""
+    type: ImageGenCompletedEventType
+    r"""The event type"""
+    usage: NotRequired[ImageGenerationUsageTypedDict]
+    r"""Token and cost usage for the image generation request, when available"""
+
+
+class ImageGenCompletedEvent(BaseModel):
+    r"""Emitted when generation completes and the final image is available"""
+
+    b64_json: str
+    r"""Base64-encoded final image data"""
+
+    created: int
+    r"""Unix timestamp (seconds) when the image was generated"""
+
+    type: ImageGenCompletedEventType
+    r"""The event type"""
+
+    usage: Optional[ImageGenerationUsage] = None
+    r"""Token and cost usage for the image generation request, when available"""
diff --git a/src/openrouter/components/imagegenerationrequest.py b/src/openrouter/components/imagegenerationrequest.py
new file mode 100644
index 00000000..2a4b849a
--- /dev/null
+++ b/src/openrouter/components/imagegenerationrequest.py
@@ -0,0 +1,590 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .contentpartimage import ContentPartImage, ContentPartImageTypedDict
+from openrouter.types import BaseModel, Nullable, UnrecognizedStr
+from openrouter.utils import validate_open_enum
+import pydantic
+from pydantic.functional_validators import PlainValidator
+from typing import Any, Dict, List, Literal, Optional, Union
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+ImageGenerationRequestAspectRatio = Union[
+    Literal[
+        "1:1",
+        "1:2",
+        "1:4",
+        "1:8",
+        "2:1",
+        "2:3",
+        "3:2",
+        "3:4",
+        "4:1",
+        "4:3",
+        "4:5",
+        "5:4",
+        "8:1",
+        "9:16",
+        "16:9",
+        "9:19.5",
+        "19.5:9",
+        "9:20",
+        "20:9",
+        "9:21",
+        "21:9",
+        "auto",
+    ],
+    UnrecognizedStr,
+]
+r"""Normalized aspect ratio of the generated image. Providers clamp to their supported subset."""
+
+
+ImageGenerationRequestBackground = Union[
+    Literal[
+        "auto",
+        "transparent",
+        "opaque",
+    ],
+    UnrecognizedStr,
+]
+r"""Background treatment. `transparent` requires an output_format that supports alpha (png or webp)."""
+
+
+ImageGenerationRequestOutputFormat = Union[
+    Literal[
+        "png",
+        "jpeg",
+        "webp",
+    ],
+    UnrecognizedStr,
+]
+r"""Encoding of the returned image bytes."""
+
+
+class ImageGenerationRequestOptionsTypedDict(TypedDict):
+    r"""Provider-specific options keyed by provider slug. Only options for the matched provider are forwarded; the rest are ignored. Unrecognized keys are silently dropped."""
+
+    oneai: NotRequired[Dict[str, Nullable[Any]]]
+    ai21: NotRequired[Dict[str, Nullable[Any]]]
+    aion_labs: NotRequired[Dict[str, Nullable[Any]]]
+    akashml: NotRequired[Dict[str, Nullable[Any]]]
+    alibaba: NotRequired[Dict[str, Nullable[Any]]]
+    amazon_bedrock: NotRequired[Dict[str, Nullable[Any]]]
+    amazon_nova: NotRequired[Dict[str, Nullable[Any]]]
+    ambient: NotRequired[Dict[str, Nullable[Any]]]
+    anthropic: NotRequired[Dict[str, Nullable[Any]]]
+    anyscale: NotRequired[Dict[str, Nullable[Any]]]
+    arcee_ai: NotRequired[Dict[str, Nullable[Any]]]
+    atlas_cloud: NotRequired[Dict[str, Nullable[Any]]]
+    atoma: NotRequired[Dict[str, Nullable[Any]]]
+    avian: NotRequired[Dict[str, Nullable[Any]]]
+    azure: NotRequired[Dict[str, Nullable[Any]]]
+    baidu: NotRequired[Dict[str, Nullable[Any]]]
+    baseten: NotRequired[Dict[str, Nullable[Any]]]
+    black_forest_labs: NotRequired[Dict[str, Nullable[Any]]]
+    byteplus: NotRequired[Dict[str, Nullable[Any]]]
+    centml: NotRequired[Dict[str, Nullable[Any]]]
+    cerebras: NotRequired[Dict[str, Nullable[Any]]]
+    chutes: NotRequired[Dict[str, Nullable[Any]]]
+    cirrascale: NotRequired[Dict[str, Nullable[Any]]]
+    clarifai: NotRequired[Dict[str, Nullable[Any]]]
+    cloudflare: NotRequired[Dict[str, Nullable[Any]]]
+    cohere: NotRequired[Dict[str, Nullable[Any]]]
+    crofai: NotRequired[Dict[str, Nullable[Any]]]
+    crucible: NotRequired[Dict[str, Nullable[Any]]]
+    crusoe: NotRequired[Dict[str, Nullable[Any]]]
+    darkbloom: NotRequired[Dict[str, Nullable[Any]]]
+    decart: NotRequired[Dict[str, Nullable[Any]]]
+    deepinfra: NotRequired[Dict[str, Nullable[Any]]]
+    deepseek: NotRequired[Dict[str, Nullable[Any]]]
+    dekallm: NotRequired[Dict[str, Nullable[Any]]]
+    digitalocean: NotRequired[Dict[str, Nullable[Any]]]
+    enfer: NotRequired[Dict[str, Nullable[Any]]]
+    fake_provider: NotRequired[Dict[str, Nullable[Any]]]
+    featherless: NotRequired[Dict[str, Nullable[Any]]]
+    fireworks: NotRequired[Dict[str, Nullable[Any]]]
+    friendli: NotRequired[Dict[str, Nullable[Any]]]
+    gmicloud: NotRequired[Dict[str, Nullable[Any]]]
+    google_ai_studio: NotRequired[Dict[str, Nullable[Any]]]
+    google_vertex: NotRequired[Dict[str, Nullable[Any]]]
+    gopomelo: NotRequired[Dict[str, Nullable[Any]]]
+    groq: NotRequired[Dict[str, Nullable[Any]]]
+    huggingface: NotRequired[Dict[str, Nullable[Any]]]
+    hyperbolic: NotRequired[Dict[str, Nullable[Any]]]
+    hyperbolic_quantized: NotRequired[Dict[str, Nullable[Any]]]
+    inception: NotRequired[Dict[str, Nullable[Any]]]
+    inceptron: NotRequired[Dict[str, Nullable[Any]]]
+    inference_net: NotRequired[Dict[str, Nullable[Any]]]
+    infermatic: NotRequired[Dict[str, Nullable[Any]]]
+    inflection: NotRequired[Dict[str, Nullable[Any]]]
+    inocloud: NotRequired[Dict[str, Nullable[Any]]]
+    io_net: NotRequired[Dict[str, Nullable[Any]]]
+    ionstream: NotRequired[Dict[str, Nullable[Any]]]
+    klusterai: NotRequired[Dict[str, Nullable[Any]]]
+    lambda_: NotRequired[Dict[str, Nullable[Any]]]
+    lepton: NotRequired[Dict[str, Nullable[Any]]]
+    liquid: NotRequired[Dict[str, Nullable[Any]]]
+    lynn: NotRequired[Dict[str, Nullable[Any]]]
+    lynn_private: NotRequired[Dict[str, Nullable[Any]]]
+    mancer: NotRequired[Dict[str, Nullable[Any]]]
+    mancer_old: NotRequired[Dict[str, Nullable[Any]]]
+    mara: NotRequired[Dict[str, Nullable[Any]]]
+    meta: NotRequired[Dict[str, Nullable[Any]]]
+    minimax: NotRequired[Dict[str, Nullable[Any]]]
+    mistral: NotRequired[Dict[str, Nullable[Any]]]
+    modal: NotRequired[Dict[str, Nullable[Any]]]
+    modelrun: NotRequired[Dict[str, Nullable[Any]]]
+    modular: NotRequired[Dict[str, Nullable[Any]]]
+    moonshotai: NotRequired[Dict[str, Nullable[Any]]]
+    morph: NotRequired[Dict[str, Nullable[Any]]]
+    ncompass: NotRequired[Dict[str, Nullable[Any]]]
+    nebius: NotRequired[Dict[str, Nullable[Any]]]
+    nex_agi: NotRequired[Dict[str, Nullable[Any]]]
+    nextbit: NotRequired[Dict[str, Nullable[Any]]]
+    nineteen: NotRequired[Dict[str, Nullable[Any]]]
+    novita: NotRequired[Dict[str, Nullable[Any]]]
+    nvidia: NotRequired[Dict[str, Nullable[Any]]]
+    octoai: NotRequired[Dict[str, Nullable[Any]]]
+    open_inference: NotRequired[Dict[str, Nullable[Any]]]
+    openai: NotRequired[Dict[str, Nullable[Any]]]
+    parasail: NotRequired[Dict[str, Nullable[Any]]]
+    perceptron: NotRequired[Dict[str, Nullable[Any]]]
+    perplexity: NotRequired[Dict[str, Nullable[Any]]]
+    phala: NotRequired[Dict[str, Nullable[Any]]]
+    poolside: NotRequired[Dict[str, Nullable[Any]]]
+    recraft: NotRequired[Dict[str, Nullable[Any]]]
+    recursal: NotRequired[Dict[str, Nullable[Any]]]
+    reflection: NotRequired[Dict[str, Nullable[Any]]]
+    reka: NotRequired[Dict[str, Nullable[Any]]]
+    relace: NotRequired[Dict[str, Nullable[Any]]]
+    replicate: NotRequired[Dict[str, Nullable[Any]]]
+    sambanova: NotRequired[Dict[str, Nullable[Any]]]
+    sambanova_cloaked: NotRequired[Dict[str, Nullable[Any]]]
+    seed: NotRequired[Dict[str, Nullable[Any]]]
+    sf_compute: NotRequired[Dict[str, Nullable[Any]]]
+    siliconflow: NotRequired[Dict[str, Nullable[Any]]]
+    sourceful: NotRequired[Dict[str, Nullable[Any]]]
+    stealth: NotRequired[Dict[str, Nullable[Any]]]
+    stepfun: NotRequired[Dict[str, Nullable[Any]]]
+    streamlake: NotRequired[Dict[str, Nullable[Any]]]
+    switchpoint: NotRequired[Dict[str, Nullable[Any]]]
+    targon: NotRequired[Dict[str, Nullable[Any]]]
+    together: NotRequired[Dict[str, Nullable[Any]]]
+    together_lite: NotRequired[Dict[str, Nullable[Any]]]
+    ubicloud: NotRequired[Dict[str, Nullable[Any]]]
+    upstage: NotRequired[Dict[str, Nullable[Any]]]
+    venice: NotRequired[Dict[str, Nullable[Any]]]
+    wafer: NotRequired[Dict[str, Nullable[Any]]]
+    wandb: NotRequired[Dict[str, Nullable[Any]]]
+    xai: NotRequired[Dict[str, Nullable[Any]]]
+    xiaomi: NotRequired[Dict[str, Nullable[Any]]]
+    z_ai: NotRequired[Dict[str, Nullable[Any]]]
+
+
+class ImageGenerationRequestOptions(BaseModel):
+    r"""Provider-specific options keyed by provider slug. Only options for the matched provider are forwarded; the rest are ignored. Unrecognized keys are silently dropped."""
+
+    oneai: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="01ai")
+    ] = None
+
+    ai21: Optional[Dict[str, Nullable[Any]]] = None
+
+    aion_labs: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="aion-labs")
+    ] = None
+
+    akashml: Optional[Dict[str, Nullable[Any]]] = None
+
+    alibaba: Optional[Dict[str, Nullable[Any]]] = None
+
+    amazon_bedrock: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="amazon-bedrock")
+    ] = None
+
+    amazon_nova: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="amazon-nova")
+    ] = None
+
+    ambient: Optional[Dict[str, Nullable[Any]]] = None
+
+    anthropic: Optional[Dict[str, Nullable[Any]]] = None
+
+    anyscale: Optional[Dict[str, Nullable[Any]]] = None
+
+    arcee_ai: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="arcee-ai")
+    ] = None
+
+    atlas_cloud: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="atlas-cloud")
+    ] = None
+
+    atoma: Optional[Dict[str, Nullable[Any]]] = None
+
+    avian: Optional[Dict[str, Nullable[Any]]] = None
+
+    azure: Optional[Dict[str, Nullable[Any]]] = None
+
+    baidu: Optional[Dict[str, Nullable[Any]]] = None
+
+    baseten: Optional[Dict[str, Nullable[Any]]] = None
+
+    black_forest_labs: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="black-forest-labs")
+    ] = None
+
+    byteplus: Optional[Dict[str, Nullable[Any]]] = None
+
+    centml: Optional[Dict[str, Nullable[Any]]] = None
+
+    cerebras: Optional[Dict[str, Nullable[Any]]] = None
+
+    chutes: Optional[Dict[str, Nullable[Any]]] = None
+
+    cirrascale: Optional[Dict[str, Nullable[Any]]] = None
+
+    clarifai: Optional[Dict[str, Nullable[Any]]] = None
+
+    cloudflare: Optional[Dict[str, Nullable[Any]]] = None
+
+    cohere: Optional[Dict[str, Nullable[Any]]] = None
+
+    crofai: Optional[Dict[str, Nullable[Any]]] = None
+
+    crucible: Optional[Dict[str, Nullable[Any]]] = None
+
+    crusoe: Optional[Dict[str, Nullable[Any]]] = None
+
+    darkbloom: Optional[Dict[str, Nullable[Any]]] = None
+
+    decart: Optional[Dict[str, Nullable[Any]]] = None
+
+    deepinfra: Optional[Dict[str, Nullable[Any]]] = None
+
+    deepseek: Optional[Dict[str, Nullable[Any]]] = None
+
+    dekallm: Optional[Dict[str, Nullable[Any]]] = None
+
+    digitalocean: Optional[Dict[str, Nullable[Any]]] = None
+
+    enfer: Optional[Dict[str, Nullable[Any]]] = None
+
+    fake_provider: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="fake-provider")
+    ] = None
+
+    featherless: Optional[Dict[str, Nullable[Any]]] = None
+
+    fireworks: Optional[Dict[str, Nullable[Any]]] = None
+
+    friendli: Optional[Dict[str, Nullable[Any]]] = None
+
+    gmicloud: Optional[Dict[str, Nullable[Any]]] = None
+
+    google_ai_studio: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="google-ai-studio")
+    ] = None
+
+    google_vertex: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="google-vertex")
+    ] = None
+
+    gopomelo: Optional[Dict[str, Nullable[Any]]] = None
+
+    groq: Optional[Dict[str, Nullable[Any]]] = None
+
+    huggingface: Optional[Dict[str, Nullable[Any]]] = None
+
+    hyperbolic: Optional[Dict[str, Nullable[Any]]] = None
+
+    hyperbolic_quantized: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="hyperbolic-quantized")
+    ] = None
+
+    inception: Optional[Dict[str, Nullable[Any]]] = None
+
+    inceptron: Optional[Dict[str, Nullable[Any]]] = None
+
+    inference_net: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="inference-net")
+    ] = None
+
+    infermatic: Optional[Dict[str, Nullable[Any]]] = None
+
+    inflection: Optional[Dict[str, Nullable[Any]]] = None
+
+    inocloud: Optional[Dict[str, Nullable[Any]]] = None
+
+    io_net: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="io-net")
+    ] = None
+
+    ionstream: Optional[Dict[str, Nullable[Any]]] = None
+
+    klusterai: Optional[Dict[str, Nullable[Any]]] = None
+
+    lambda_: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="lambda")
+    ] = None
+
+    lepton: Optional[Dict[str, Nullable[Any]]] = None
+
+    liquid: Optional[Dict[str, Nullable[Any]]] = None
+
+    lynn: Optional[Dict[str, Nullable[Any]]] = None
+
+    lynn_private: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="lynn-private")
+    ] = None
+
+    mancer: Optional[Dict[str, Nullable[Any]]] = None
+
+    mancer_old: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="mancer-old")
+    ] = None
+
+    mara: Optional[Dict[str, Nullable[Any]]] = None
+
+    meta: Optional[Dict[str, Nullable[Any]]] = None
+
+    minimax: Optional[Dict[str, Nullable[Any]]] = None
+
+    mistral: Optional[Dict[str, Nullable[Any]]] = None
+
+    modal: Optional[Dict[str, Nullable[Any]]] = None
+
+    modelrun: Optional[Dict[str, Nullable[Any]]] = None
+
+    modular: Optional[Dict[str, Nullable[Any]]] = None
+
+    moonshotai: Optional[Dict[str, Nullable[Any]]] = None
+
+    morph: Optional[Dict[str, Nullable[Any]]] = None
+
+    ncompass: Optional[Dict[str, Nullable[Any]]] = None
+
+    nebius: Optional[Dict[str, Nullable[Any]]] = None
+
+    nex_agi: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="nex-agi")
+    ] = None
+
+    nextbit: Optional[Dict[str, Nullable[Any]]] = None
+
+    nineteen: Optional[Dict[str, Nullable[Any]]] = None
+
+    novita: Optional[Dict[str, Nullable[Any]]] = None
+
+    nvidia: Optional[Dict[str, Nullable[Any]]] = None
+
+    octoai: Optional[Dict[str, Nullable[Any]]] = None
+
+    open_inference: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="open-inference")
+    ] = None
+
+    openai: Optional[Dict[str, Nullable[Any]]] = None
+
+    parasail: Optional[Dict[str, Nullable[Any]]] = None
+
+    perceptron: Optional[Dict[str, Nullable[Any]]] = None
+
+    perplexity: Optional[Dict[str, Nullable[Any]]] = None
+
+    phala: Optional[Dict[str, Nullable[Any]]] = None
+
+    poolside: Optional[Dict[str, Nullable[Any]]] = None
+
+    recraft: Optional[Dict[str, Nullable[Any]]] = None
+
+    recursal: Optional[Dict[str, Nullable[Any]]] = None
+
+    reflection: Optional[Dict[str, Nullable[Any]]] = None
+
+    reka: Optional[Dict[str, Nullable[Any]]] = None
+
+    relace: Optional[Dict[str, Nullable[Any]]] = None
+
+    replicate: Optional[Dict[str, Nullable[Any]]] = None
+
+    sambanova: Optional[Dict[str, Nullable[Any]]] = None
+
+    sambanova_cloaked: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="sambanova-cloaked")
+    ] = None
+
+    seed: Optional[Dict[str, Nullable[Any]]] = None
+
+    sf_compute: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="sf-compute")
+    ] = None
+
+    siliconflow: Optional[Dict[str, Nullable[Any]]] = None
+
+    sourceful: Optional[Dict[str, Nullable[Any]]] = None
+
+    stealth: Optional[Dict[str, Nullable[Any]]] = None
+
+    stepfun: Optional[Dict[str, Nullable[Any]]] = None
+
+    streamlake: Optional[Dict[str, Nullable[Any]]] = None
+
+    switchpoint: Optional[Dict[str, Nullable[Any]]] = None
+
+    targon: Optional[Dict[str, Nullable[Any]]] = None
+
+    together: Optional[Dict[str, Nullable[Any]]] = None
+
+    together_lite: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="together-lite")
+    ] = None
+
+    ubicloud: Optional[Dict[str, Nullable[Any]]] = None
+
+    upstage: Optional[Dict[str, Nullable[Any]]] = None
+
+    venice: Optional[Dict[str, Nullable[Any]]] = None
+
+    wafer: Optional[Dict[str, Nullable[Any]]] = None
+
+    wandb: Optional[Dict[str, Nullable[Any]]] = None
+
+    xai: Optional[Dict[str, Nullable[Any]]] = None
+
+    xiaomi: Optional[Dict[str, Nullable[Any]]] = None
+
+    z_ai: Annotated[
+        Optional[Dict[str, Nullable[Any]]], pydantic.Field(alias="z-ai")
+    ] = None
+
+
+class ImageGenerationRequestProviderTypedDict(TypedDict):
+    r"""Provider-specific passthrough configuration"""
+
+    options: NotRequired[ImageGenerationRequestOptionsTypedDict]
+
+
+class ImageGenerationRequestProvider(BaseModel):
+    r"""Provider-specific passthrough configuration"""
+
+    options: Optional[ImageGenerationRequestOptions] = None
+
+
+ImageGenerationRequestQuality = Union[
+    Literal[
+        "auto",
+        "low",
+        "medium",
+        "high",
+    ],
+    UnrecognizedStr,
+]
+r"""Rendering quality. Providers without a quality knob ignore this."""
+
+
+ImageGenerationRequestResolution = Union[
+    Literal[
+        "512",
+        "1K",
+        "2K",
+        "4K",
+    ],
+    UnrecognizedStr,
+]
+r"""Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider."""
+
+
+class ImageGenerationRequestTypedDict(TypedDict):
+    r"""Image generation request input"""
+
+    model: str
+    r"""The image generation model to use"""
+    prompt: str
+    r"""Text description of the desired image"""
+    aspect_ratio: NotRequired[ImageGenerationRequestAspectRatio]
+    r"""Normalized aspect ratio of the generated image. Providers clamp to their supported subset."""
+    background: NotRequired[ImageGenerationRequestBackground]
+    r"""Background treatment. `transparent` requires an output_format that supports alpha (png or webp)."""
+    input_references: NotRequired[List[ContentPartImageTypedDict]]
+    r"""Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs."""
+    n: NotRequired[int]
+    r"""Number of images to generate (1-10). Providers that only support single-image generation reject n > 1."""
+    output_compression: NotRequired[int]
+    r"""Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob."""
+    output_format: NotRequired[ImageGenerationRequestOutputFormat]
+    r"""Encoding of the returned image bytes."""
+    provider: NotRequired[ImageGenerationRequestProviderTypedDict]
+    r"""Provider-specific passthrough configuration"""
+    quality: NotRequired[ImageGenerationRequestQuality]
+    r"""Rendering quality. Providers without a quality knob ignore this."""
+    resolution: NotRequired[ImageGenerationRequestResolution]
+    r"""Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider."""
+    seed: NotRequired[int]
+    r"""If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers."""
+    size: NotRequired[str]
+    r"""Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected."""
+    stream: NotRequired[bool]
+    r"""If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response."""
+
+
+class ImageGenerationRequest(BaseModel):
+    r"""Image generation request input"""
+
+    model: str
+    r"""The image generation model to use"""
+
+    prompt: str
+    r"""Text description of the desired image"""
+
+    aspect_ratio: Annotated[
+        Optional[ImageGenerationRequestAspectRatio],
+        PlainValidator(validate_open_enum(False)),
+    ] = None
+    r"""Normalized aspect ratio of the generated image. Providers clamp to their supported subset."""
+
+    background: Annotated[
+        Optional[ImageGenerationRequestBackground],
+        PlainValidator(validate_open_enum(False)),
+    ] = None
+    r"""Background treatment. `transparent` requires an output_format that supports alpha (png or webp)."""
+
+    input_references: Optional[List[ContentPartImage]] = None
+    r"""Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs."""
+
+    n: Optional[int] = None
+    r"""Number of images to generate (1-10). Providers that only support single-image generation reject n > 1."""
+
+    output_compression: Optional[int] = None
+    r"""Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob."""
+
+    output_format: Annotated[
+        Optional[ImageGenerationRequestOutputFormat],
+        PlainValidator(validate_open_enum(False)),
+    ] = None
+    r"""Encoding of the returned image bytes."""
+
+    provider: Optional[ImageGenerationRequestProvider] = None
+    r"""Provider-specific passthrough configuration"""
+
+    quality: Annotated[
+        Optional[ImageGenerationRequestQuality],
+        PlainValidator(validate_open_enum(False)),
+    ] = None
+    r"""Rendering quality. Providers without a quality knob ignore this."""
+
+    resolution: Annotated[
+        Optional[ImageGenerationRequestResolution],
+        PlainValidator(validate_open_enum(False)),
+    ] = None
+    r"""Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider."""
+
+    seed: Optional[int] = None
+    r"""If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers."""
+
+    size: Optional[str] = None
+    r"""Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected."""
+
+    stream: Optional[bool] = None
+    r"""If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response."""
diff --git a/src/openrouter/components/imagegenerationresponse.py b/src/openrouter/components/imagegenerationresponse.py
new file mode 100644
index 00000000..deb67493
--- /dev/null
+++ b/src/openrouter/components/imagegenerationresponse.py
@@ -0,0 +1,41 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .imagegenerationusage import ImageGenerationUsage, ImageGenerationUsageTypedDict
+from openrouter.types import BaseModel
+from typing import List, Optional
+from typing_extensions import NotRequired, TypedDict
+
+
+class ImageGenerationResponseDataTypedDict(TypedDict):
+    b64_json: str
+    r"""Base64-encoded image bytes"""
+
+
+class ImageGenerationResponseData(BaseModel):
+    b64_json: str
+    r"""Base64-encoded image bytes"""
+
+
+class ImageGenerationResponseTypedDict(TypedDict):
+    r"""Image generation response"""
+
+    created: int
+    r"""Unix timestamp (seconds) when the image was generated"""
+    data: List[ImageGenerationResponseDataTypedDict]
+    r"""Generated images"""
+    usage: NotRequired[ImageGenerationUsageTypedDict]
+    r"""Token and cost usage for the image generation request, when available"""
+
+
+class ImageGenerationResponse(BaseModel):
+    r"""Image generation response"""
+
+    created: int
+    r"""Unix timestamp (seconds) when the image was generated"""
+
+    data: List[ImageGenerationResponseData]
+    r"""Generated images"""
+
+    usage: Optional[ImageGenerationUsage] = None
+    r"""Token and cost usage for the image generation request, when available"""
diff --git a/src/openrouter/components/imagegenerationservertool.py b/src/openrouter/components/imagegenerationservertool.py
index 1bb37648..dfcb122b 100644
--- a/src/openrouter/components/imagegenerationservertool.py
+++ b/src/openrouter/components/imagegenerationservertool.py
@@ -16,7 +16,7 @@
 from typing_extensions import Annotated, NotRequired, TypedDict
 
 
-Background = Union[
+ImageGenerationServerToolBackground = Union[
     Literal[
         "transparent",
         "opaque",
@@ -64,7 +64,7 @@ class InputImageMask(BaseModel):
 ]
 
 
-OutputFormat = Union[
+ImageGenerationServerToolOutputFormat = Union[
     Literal[
         "png",
         "webp",
@@ -74,7 +74,7 @@ class InputImageMask(BaseModel):
 ]
 
 
-Quality = Union[
+ImageGenerationServerToolQuality = Union[
     Literal[
         "low",
         "medium",
@@ -103,15 +103,15 @@ class ImageGenerationServerToolTypedDict(TypedDict):
     r"""Image generation tool configuration"""
 
     type: ImageGenerationServerToolType
-    background: NotRequired[Background]
+    background: NotRequired[ImageGenerationServerToolBackground]
     input_fidelity: NotRequired[Nullable[InputFidelity]]
     input_image_mask: NotRequired[InputImageMaskTypedDict]
     model: NotRequired[ModelEnum]
     moderation: NotRequired[Moderation]
     output_compression: NotRequired[int]
-    output_format: NotRequired[OutputFormat]
+    output_format: NotRequired[ImageGenerationServerToolOutputFormat]
     partial_images: NotRequired[int]
-    quality: NotRequired[Quality]
+    quality: NotRequired[ImageGenerationServerToolQuality]
     size: NotRequired[Size]
 
 
@@ -121,7 +121,8 @@ class ImageGenerationServerTool(BaseModel):
     type: ImageGenerationServerToolType
 
     background: Annotated[
-        Optional[Background], PlainValidator(validate_open_enum(False))
+        Optional[ImageGenerationServerToolBackground],
+        PlainValidator(validate_open_enum(False)),
     ] = None
 
     input_fidelity: Annotated[
@@ -141,14 +142,16 @@ class ImageGenerationServerTool(BaseModel):
     output_compression: Optional[int] = None
 
     output_format: Annotated[
-        Optional[OutputFormat], PlainValidator(validate_open_enum(False))
+        Optional[ImageGenerationServerToolOutputFormat],
+        PlainValidator(validate_open_enum(False)),
     ] = None
 
     partial_images: Optional[int] = None
 
-    quality: Annotated[Optional[Quality], PlainValidator(validate_open_enum(False))] = (
-        None
-    )
+    quality: Annotated[
+        Optional[ImageGenerationServerToolQuality],
+        PlainValidator(validate_open_enum(False)),
+    ] = None
 
     size: Annotated[Optional[Size], PlainValidator(validate_open_enum(False))] = None
 
diff --git a/src/openrouter/components/imagegenerationusage.py b/src/openrouter/components/imagegenerationusage.py
new file mode 100644
index 00000000..ddc1c845
--- /dev/null
+++ b/src/openrouter/components/imagegenerationusage.py
@@ -0,0 +1,331 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .anthropicspeed import AnthropicSpeed
+from .anthropicusageiteration import (
+    AnthropicUsageIteration,
+    AnthropicUsageIterationTypedDict,
+)
+from .costdetails import CostDetails, CostDetailsTypedDict
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+)
+from openrouter.utils import validate_open_enum
+from pydantic import model_serializer
+from pydantic.functional_validators import PlainValidator
+from typing import List, Optional
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+class ImageGenerationUsageCompletionTokensDetailsTypedDict(TypedDict):
+    audio_tokens: NotRequired[Nullable[int]]
+    r"""Tokens generated by the model for audio output."""
+    image_tokens: NotRequired[Nullable[int]]
+    r"""Tokens generated by the model for image output."""
+    reasoning_tokens: NotRequired[Nullable[int]]
+    r"""Tokens generated by the model for reasoning."""
+
+
+class ImageGenerationUsageCompletionTokensDetails(BaseModel):
+    audio_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens generated by the model for audio output."""
+
+    image_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens generated by the model for image output."""
+
+    reasoning_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens generated by the model for reasoning."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = ["audio_tokens", "image_tokens", "reasoning_tokens"]
+        nullable_fields = ["audio_tokens", "image_tokens", "reasoning_tokens"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
+
+class ImageGenerationUsagePromptTokensDetailsTypedDict(TypedDict):
+    r"""Breakdown of tokens used in the prompt."""
+
+    audio_tokens: NotRequired[Nullable[int]]
+    r"""Tokens used for input audio."""
+    cache_write_tokens: NotRequired[Nullable[int]]
+    r"""Tokens written to cache. Only returned for models with explicit caching and cache write pricing."""
+    cached_tokens: NotRequired[Nullable[int]]
+    r"""Tokens cached by the endpoint."""
+    file_tokens: NotRequired[Nullable[int]]
+    r"""Tokens used for input files/documents."""
+    video_tokens: NotRequired[Nullable[int]]
+    r"""Tokens used for input video."""
+
+
+class ImageGenerationUsagePromptTokensDetails(BaseModel):
+    r"""Breakdown of tokens used in the prompt."""
+
+    audio_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens used for input audio."""
+
+    cache_write_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens written to cache. Only returned for models with explicit caching and cache write pricing."""
+
+    cached_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens cached by the endpoint."""
+
+    file_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens used for input files/documents."""
+
+    video_tokens: OptionalNullable[int] = UNSET
+    r"""Tokens used for input video."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "audio_tokens",
+            "cache_write_tokens",
+            "cached_tokens",
+            "file_tokens",
+            "video_tokens",
+        ]
+        nullable_fields = [
+            "audio_tokens",
+            "cache_write_tokens",
+            "cached_tokens",
+            "file_tokens",
+            "video_tokens",
+        ]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
+
+class ServerToolUseTypedDict(TypedDict):
+    r"""Usage for server-side tool execution (e.g., web search)"""
+
+    tool_calls_executed: NotRequired[Nullable[int]]
+    r"""Number of OpenRouter server tool calls that executed and produced a result."""
+    tool_calls_requested: NotRequired[Nullable[int]]
+    r"""Total number of OpenRouter server-orchestrated tool calls the model requested, across all tool types. Provider-native tools (e.g. native web search) are not counted here."""
+    web_search_requests: NotRequired[Nullable[int]]
+    r"""Number of web searches performed by server-side tools. For server-orchestrated tool calls a web search is also counted in tool_calls_requested; provider-native web search may report web_search_requests only. Do not sum the two."""
+
+
+class ServerToolUse(BaseModel):
+    r"""Usage for server-side tool execution (e.g., web search)"""
+
+    tool_calls_executed: OptionalNullable[int] = UNSET
+    r"""Number of OpenRouter server tool calls that executed and produced a result."""
+
+    tool_calls_requested: OptionalNullable[int] = UNSET
+    r"""Total number of OpenRouter server-orchestrated tool calls the model requested, across all tool types. Provider-native tools (e.g. native web search) are not counted here."""
+
+    web_search_requests: OptionalNullable[int] = UNSET
+    r"""Number of web searches performed by server-side tools. For server-orchestrated tool calls a web search is also counted in tool_calls_requested; provider-native web search may report web_search_requests only. Do not sum the two."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "tool_calls_executed",
+            "tool_calls_requested",
+            "web_search_requests",
+        ]
+        nullable_fields = [
+            "tool_calls_executed",
+            "tool_calls_requested",
+            "web_search_requests",
+        ]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
+
+class ImageGenerationUsageTypedDict(TypedDict):
+    r"""Token and cost usage for the image generation request, when available"""
+
+    completion_tokens: int
+    r"""The tokens generated"""
+    prompt_tokens: int
+    r"""Including images, input audio, and tools if any"""
+    total_tokens: int
+    r"""Sum of the above two fields"""
+    completion_tokens_details: NotRequired[
+        Nullable[ImageGenerationUsageCompletionTokensDetailsTypedDict]
+    ]
+    cost: NotRequired[Nullable[float]]
+    r"""Cost of the completion"""
+    cost_details: NotRequired[Nullable[CostDetailsTypedDict]]
+    r"""Breakdown of upstream inference costs"""
+    is_byok: NotRequired[bool]
+    r"""Whether a request was made using a Bring Your Own Key configuration"""
+    iterations: NotRequired[Nullable[List[AnthropicUsageIterationTypedDict]]]
+    prompt_tokens_details: NotRequired[
+        Nullable[ImageGenerationUsagePromptTokensDetailsTypedDict]
+    ]
+    r"""Breakdown of tokens used in the prompt."""
+    server_tool_use: NotRequired[Nullable[ServerToolUseTypedDict]]
+    r"""Usage for server-side tool execution (e.g., web search)"""
+    service_tier: NotRequired[Nullable[str]]
+    r"""The service tier used by the upstream provider for this request"""
+    speed: NotRequired[Nullable[AnthropicSpeed]]
+
+
+class ImageGenerationUsage(BaseModel):
+    r"""Token and cost usage for the image generation request, when available"""
+
+    completion_tokens: int
+    r"""The tokens generated"""
+
+    prompt_tokens: int
+    r"""Including images, input audio, and tools if any"""
+
+    total_tokens: int
+    r"""Sum of the above two fields"""
+
+    completion_tokens_details: OptionalNullable[
+        ImageGenerationUsageCompletionTokensDetails
+    ] = UNSET
+
+    cost: OptionalNullable[float] = UNSET
+    r"""Cost of the completion"""
+
+    cost_details: OptionalNullable[CostDetails] = UNSET
+    r"""Breakdown of upstream inference costs"""
+
+    is_byok: Optional[bool] = None
+    r"""Whether a request was made using a Bring Your Own Key configuration"""
+
+    iterations: OptionalNullable[List[AnthropicUsageIteration]] = UNSET
+
+    prompt_tokens_details: OptionalNullable[ImageGenerationUsagePromptTokensDetails] = (
+        UNSET
+    )
+    r"""Breakdown of tokens used in the prompt."""
+
+    server_tool_use: OptionalNullable[ServerToolUse] = UNSET
+    r"""Usage for server-side tool execution (e.g., web search)"""
+
+    service_tier: OptionalNullable[str] = UNSET
+    r"""The service tier used by the upstream provider for this request"""
+
+    speed: Annotated[
+        OptionalNullable[AnthropicSpeed], PlainValidator(validate_open_enum(False))
+    ] = UNSET
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "completion_tokens_details",
+            "cost",
+            "cost_details",
+            "is_byok",
+            "iterations",
+            "prompt_tokens_details",
+            "server_tool_use",
+            "service_tier",
+            "speed",
+        ]
+        nullable_fields = [
+            "completion_tokens_details",
+            "cost",
+            "cost_details",
+            "iterations",
+            "prompt_tokens_details",
+            "server_tool_use",
+            "service_tier",
+            "speed",
+        ]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/imagegenpartialimageevent.py b/src/openrouter/components/imagegenpartialimageevent.py
new file mode 100644
index 00000000..ad454de8
--- /dev/null
+++ b/src/openrouter/components/imagegenpartialimageevent.py
@@ -0,0 +1,34 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel
+from typing import Literal
+from typing_extensions import TypedDict
+
+
+ImageGenPartialImageEventType = Literal["image_generation.partial_image",]
+r"""The event type"""
+
+
+class ImageGenPartialImageEventTypedDict(TypedDict):
+    r"""Emitted when a partial image becomes available during streaming generation"""
+
+    b64_json: str
+    r"""Base64-encoded partial image data"""
+    partial_image_index: int
+    r"""0-based index indicating which partial image this is in the sequence"""
+    type: ImageGenPartialImageEventType
+    r"""The event type"""
+
+
+class ImageGenPartialImageEvent(BaseModel):
+    r"""Emitted when a partial image becomes available during streaming generation"""
+
+    b64_json: str
+    r"""Base64-encoded partial image data"""
+
+    partial_image_index: int
+    r"""0-based index indicating which partial image this is in the sequence"""
+
+    type: ImageGenPartialImageEventType
+    r"""The event type"""
diff --git a/src/openrouter/components/imagegenstreamerrorevent.py b/src/openrouter/components/imagegenstreamerrorevent.py
new file mode 100644
index 00000000..9396413a
--- /dev/null
+++ b/src/openrouter/components/imagegenstreamerrorevent.py
@@ -0,0 +1,95 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+)
+from pydantic import model_serializer
+from typing import Literal
+from typing_extensions import NotRequired, TypedDict
+
+
+class ImageGenStreamErrorEventErrorTypedDict(TypedDict):
+    r"""Provider error details"""
+
+    message: str
+    r"""Provider error message"""
+    code: NotRequired[Nullable[str]]
+    r"""Provider error code, when supplied"""
+    param: NotRequired[Nullable[str]]
+    r"""Request parameter associated with the error, when supplied"""
+    type: NotRequired[Nullable[str]]
+    r"""Provider error type, when supplied"""
+
+
+class ImageGenStreamErrorEventError(BaseModel):
+    r"""Provider error details"""
+
+    message: str
+    r"""Provider error message"""
+
+    code: OptionalNullable[str] = UNSET
+    r"""Provider error code, when supplied"""
+
+    param: OptionalNullable[str] = UNSET
+    r"""Request parameter associated with the error, when supplied"""
+
+    type: OptionalNullable[str] = UNSET
+    r"""Provider error type, when supplied"""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = ["code", "param", "type"]
+        nullable_fields = ["code", "param", "type"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
+
+ImageGenStreamErrorEventType = Literal["error",]
+r"""The event type"""
+
+
+class ImageGenStreamErrorEventTypedDict(TypedDict):
+    r"""Emitted when streaming generation fails after the SSE response starts"""
+
+    error: ImageGenStreamErrorEventErrorTypedDict
+    r"""Provider error details"""
+    type: ImageGenStreamErrorEventType
+    r"""The event type"""
+
+
+class ImageGenStreamErrorEvent(BaseModel):
+    r"""Emitted when streaming generation fails after the SSE response starts"""
+
+    error: ImageGenStreamErrorEventError
+    r"""Provider error details"""
+
+    type: ImageGenStreamErrorEventType
+    r"""The event type"""
diff --git a/src/openrouter/components/imagemodelarchitecture.py b/src/openrouter/components/imagemodelarchitecture.py
new file mode 100644
index 00000000..5e93aaa1
--- /dev/null
+++ b/src/openrouter/components/imagemodelarchitecture.py
@@ -0,0 +1,29 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .imageoutputmodality import ImageOutputModality
+from .inputmodality import InputModality
+from openrouter.types import BaseModel
+from openrouter.utils import validate_open_enum
+from pydantic.functional_validators import PlainValidator
+from typing import List
+from typing_extensions import Annotated, TypedDict
+
+
+class ImageModelArchitectureTypedDict(TypedDict):
+    input_modalities: List[InputModality]
+    r"""Supported input modalities"""
+    output_modalities: List[ImageOutputModality]
+    r"""Supported output modalities"""
+
+
+class ImageModelArchitecture(BaseModel):
+    input_modalities: List[
+        Annotated[InputModality, PlainValidator(validate_open_enum(False))]
+    ]
+    r"""Supported input modalities"""
+
+    output_modalities: List[
+        Annotated[ImageOutputModality, PlainValidator(validate_open_enum(False))]
+    ]
+    r"""Supported output modalities"""
diff --git a/src/openrouter/components/imagemodelendpointsresponse.py b/src/openrouter/components/imagemodelendpointsresponse.py
new file mode 100644
index 00000000..d97d1ee6
--- /dev/null
+++ b/src/openrouter/components/imagemodelendpointsresponse.py
@@ -0,0 +1,24 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .imageendpoint import ImageEndpoint, ImageEndpointTypedDict
+from openrouter.types import BaseModel
+from typing import List
+from typing_extensions import TypedDict
+
+
+class ImageModelEndpointsResponseTypedDict(TypedDict):
+    r"""The full per-endpoint records for an image model."""
+
+    endpoints: List[ImageEndpointTypedDict]
+    id: str
+    r"""Model slug"""
+
+
+class ImageModelEndpointsResponse(BaseModel):
+    r"""The full per-endpoint records for an image model."""
+
+    endpoints: List[ImageEndpoint]
+
+    id: str
+    r"""Model slug"""
diff --git a/src/openrouter/components/imagemodellistitem.py b/src/openrouter/components/imagemodellistitem.py
new file mode 100644
index 00000000..f2bb3e29
--- /dev/null
+++ b/src/openrouter/components/imagemodellistitem.py
@@ -0,0 +1,56 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .capabilitydescriptor import CapabilityDescriptor, CapabilityDescriptorTypedDict
+from .imagemodelarchitecture import (
+    ImageModelArchitecture,
+    ImageModelArchitectureTypedDict,
+)
+from openrouter.types import BaseModel
+from typing import Dict
+from typing_extensions import TypedDict
+
+
+class ImageModelListItemTypedDict(TypedDict):
+    r"""A single image model in the discovery listing."""
+
+    architecture: ImageModelArchitectureTypedDict
+    created: int
+    r"""Unix timestamp (seconds) of when the model was created"""
+    description: str
+    endpoints: str
+    r"""Relative URL to the full per-endpoint records for this model"""
+    id: str
+    r"""Model slug"""
+    name: str
+    r"""Display name"""
+    supported_parameters: Dict[str, CapabilityDescriptorTypedDict]
+    r"""Union of supported parameters across every endpoint of this model. Coarse discovery aid; the definitive per-endpoint set is behind the endpoints URL."""
+    supports_streaming: bool
+    r"""Whether any endpoint of this model supports native SSE streaming on the dedicated Image API (i.e. `stream: true` in the request). OR across endpoints."""
+
+
+class ImageModelListItem(BaseModel):
+    r"""A single image model in the discovery listing."""
+
+    architecture: ImageModelArchitecture
+
+    created: int
+    r"""Unix timestamp (seconds) of when the model was created"""
+
+    description: str
+
+    endpoints: str
+    r"""Relative URL to the full per-endpoint records for this model"""
+
+    id: str
+    r"""Model slug"""
+
+    name: str
+    r"""Display name"""
+
+    supported_parameters: Dict[str, CapabilityDescriptor]
+    r"""Union of supported parameters across every endpoint of this model. Coarse discovery aid; the definitive per-endpoint set is behind the endpoints URL."""
+
+    supports_streaming: bool
+    r"""Whether any endpoint of this model supports native SSE streaming on the dedicated Image API (i.e. `stream: true` in the request). OR across endpoints."""
diff --git a/src/openrouter/components/imagemodelslistresponse.py b/src/openrouter/components/imagemodelslistresponse.py
new file mode 100644
index 00000000..d36ed632
--- /dev/null
+++ b/src/openrouter/components/imagemodelslistresponse.py
@@ -0,0 +1,19 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .imagemodellistitem import ImageModelListItem, ImageModelListItemTypedDict
+from openrouter.types import BaseModel
+from typing import List
+from typing_extensions import TypedDict
+
+
+class ImageModelsListResponseTypedDict(TypedDict):
+    r"""List of image generation models."""
+
+    data: List[ImageModelListItemTypedDict]
+
+
+class ImageModelsListResponse(BaseModel):
+    r"""List of image generation models."""
+
+    data: List[ImageModelListItem]
diff --git a/src/openrouter/components/imageoutputmodality.py b/src/openrouter/components/imageoutputmodality.py
new file mode 100644
index 00000000..9c5a7a43
--- /dev/null
+++ b/src/openrouter/components/imageoutputmodality.py
@@ -0,0 +1,20 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import UnrecognizedStr
+from typing import Literal, Union
+
+
+ImageOutputModality = Union[
+    Literal[
+        "text",
+        "image",
+        "embeddings",
+        "audio",
+        "video",
+        "rerank",
+        "speech",
+        "transcription",
+    ],
+    UnrecognizedStr,
+]
diff --git a/src/openrouter/components/imagepricingentry.py b/src/openrouter/components/imagepricingentry.py
new file mode 100644
index 00000000..8a870046
--- /dev/null
+++ b/src/openrouter/components/imagepricingentry.py
@@ -0,0 +1,51 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel, UnrecognizedStr
+from openrouter.utils import validate_open_enum
+from pydantic.functional_validators import PlainValidator
+from typing import Literal, Optional, Union
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+Billable = Union[
+    Literal[
+        "output_image",
+        "input_image",
+        "input_font",
+        "input_reference",
+        "input_text",
+    ],
+    UnrecognizedStr,
+]
+
+
+Unit = Union[
+    Literal[
+        "image",
+        "megapixel",
+        "token",
+    ],
+    UnrecognizedStr,
+]
+
+
+class ImagePricingEntryTypedDict(TypedDict):
+    r"""One billable pricing line for an image provider."""
+
+    billable: Billable
+    cost_usd: float
+    unit: Unit
+    variant: NotRequired[str]
+
+
+class ImagePricingEntry(BaseModel):
+    r"""One billable pricing line for an image provider."""
+
+    billable: Annotated[Billable, PlainValidator(validate_open_enum(False))]
+
+    cost_usd: float
+
+    unit: Annotated[Unit, PlainValidator(validate_open_enum(False))]
+
+    variant: Optional[str] = None
diff --git a/src/openrouter/components/imagestreamingresponse.py b/src/openrouter/components/imagestreamingresponse.py
new file mode 100644
index 00000000..74c8f066
--- /dev/null
+++ b/src/openrouter/components/imagestreamingresponse.py
@@ -0,0 +1,48 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .imagegencompletedevent import (
+    ImageGenCompletedEvent,
+    ImageGenCompletedEventTypedDict,
+)
+from .imagegenpartialimageevent import (
+    ImageGenPartialImageEvent,
+    ImageGenPartialImageEventTypedDict,
+)
+from .imagegenstreamerrorevent import (
+    ImageGenStreamErrorEvent,
+    ImageGenStreamErrorEventTypedDict,
+)
+from openrouter.types import BaseModel
+from openrouter.utils import get_discriminator
+from pydantic import Discriminator, Tag
+from typing import Union
+from typing_extensions import Annotated, TypeAliasType, TypedDict
+
+
+ImageStreamingResponseDataTypedDict = TypeAliasType(
+    "ImageStreamingResponseDataTypedDict",
+    Union[
+        ImageGenStreamErrorEventTypedDict,
+        ImageGenPartialImageEventTypedDict,
+        ImageGenCompletedEventTypedDict,
+    ],
+)
+
+
+ImageStreamingResponseData = Annotated[
+    Union[
+        Annotated[ImageGenPartialImageEvent, Tag("image_generation.partial_image")],
+        Annotated[ImageGenCompletedEvent, Tag("image_generation.completed")],
+        Annotated[ImageGenStreamErrorEvent, Tag("error")],
+    ],
+    Discriminator(lambda m: get_discriminator(m, "type", "type")),
+]
+
+
+class ImageStreamingResponseTypedDict(TypedDict):
+    data: ImageStreamingResponseDataTypedDict
+
+
+class ImageStreamingResponse(BaseModel):
+    data: ImageStreamingResponseData
diff --git a/src/openrouter/components/model.py b/src/openrouter/components/model.py
index 637b3fbe..c0345109 100644
--- a/src/openrouter/components/model.py
+++ b/src/openrouter/components/model.py
@@ -5,6 +5,7 @@
 from .modelarchitecture import ModelArchitecture, ModelArchitectureTypedDict
 from .modelbenchmarks import ModelBenchmarks, ModelBenchmarksTypedDict
 from .modellinks import ModelLinks, ModelLinksTypedDict
+from .modelreasoning import ModelReasoning, ModelReasoningTypedDict
 from .parameter import Parameter
 from .perrequestlimits import PerRequestLimits, PerRequestLimitsTypedDict
 from .publicpricing import PublicPricing, PublicPricingTypedDict
@@ -62,6 +63,8 @@ class ModelTypedDict(TypedDict):
     r"""Hugging Face model identifier, if applicable"""
     knowledge_cutoff: NotRequired[Nullable[str]]
     r"""The date up to which the model was trained on data. ISO 8601 date string (YYYY-MM-DD) or null if unknown."""
+    reasoning: NotRequired[ModelReasoningTypedDict]
+    r"""Reasoning effort configuration. Omitted for non-reasoning models and dynamic router models."""
 
 
 class Model(BaseModel):
@@ -123,6 +126,9 @@ class Model(BaseModel):
     knowledge_cutoff: OptionalNullable[str] = UNSET
     r"""The date up to which the model was trained on data. ISO 8601 date string (YYYY-MM-DD) or null if unknown."""
 
+    reasoning: Optional[ModelReasoning] = None
+    r"""Reasoning effort configuration. Omitted for non-reasoning models and dynamic router models."""
+
     @model_serializer(mode="wrap")
     def serialize_model(self, handler):
         optional_fields = [
@@ -131,6 +137,7 @@ def serialize_model(self, handler):
             "expiration_date",
             "hugging_face_id",
             "knowledge_cutoff",
+            "reasoning",
         ]
         nullable_fields = [
             "context_length",
diff --git a/src/openrouter/components/modelreasoning.py b/src/openrouter/components/modelreasoning.py
new file mode 100644
index 00000000..fa73b90a
--- /dev/null
+++ b/src/openrouter/components/modelreasoning.py
@@ -0,0 +1,107 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .reasoningeffort import ReasoningEffort
+from openrouter.types import (
+    BaseModel,
+    Nullable,
+    OptionalNullable,
+    UNSET,
+    UNSET_SENTINEL,
+    UnrecognizedStr,
+)
+from openrouter.utils import validate_open_enum
+from pydantic import model_serializer
+from pydantic.functional_validators import PlainValidator
+from typing import List, Literal, Optional, Union
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+DefaultEffort = Union[
+    Literal[
+        "max",
+        "xhigh",
+        "high",
+        "medium",
+        "low",
+        "minimal",
+        "none",
+    ],
+    UnrecognizedStr,
+]
+r"""Default reasoning effort when the client enables reasoning without specifying effort. Maps to `reasoning.effort` in chat requests. When `\"none\"`, prefer omitting effort unless the user explicitly disables reasoning."""
+
+
+class ModelReasoningTypedDict(TypedDict):
+    r"""Reasoning effort configuration. Omitted for non-reasoning models and dynamic router models."""
+
+    mandatory: bool
+    r"""When true, reasoning cannot be disabled and effort \"none\" is rejected."""
+    default_effort: NotRequired[Nullable[DefaultEffort]]
+    default_enabled: NotRequired[bool]
+    r"""Default reasoning enabled state when the client does not set `reasoning.enabled`."""
+    supported_efforts: NotRequired[Nullable[List[Nullable[ReasoningEffort]]]]
+    r"""Allowed reasoning effort values for this model, in descending effort order (highest first). Null means no allowlist — all gateway effort values are accepted."""
+    supports_max_tokens: NotRequired[bool]
+    r"""Present and `true` when the model accepts `reasoning.max_tokens` in requests (Anthropic-style) instead of or in addition to `reasoning.effort`. Omitted otherwise."""
+
+
+class ModelReasoning(BaseModel):
+    r"""Reasoning effort configuration. Omitted for non-reasoning models and dynamic router models."""
+
+    mandatory: bool
+    r"""When true, reasoning cannot be disabled and effort \"none\" is rejected."""
+
+    default_effort: Annotated[
+        OptionalNullable[DefaultEffort], PlainValidator(validate_open_enum(False))
+    ] = UNSET
+
+    default_enabled: Optional[bool] = None
+    r"""Default reasoning enabled state when the client does not set `reasoning.enabled`."""
+
+    supported_efforts: OptionalNullable[
+        List[
+            Annotated[
+                Nullable[ReasoningEffort], PlainValidator(validate_open_enum(False))
+            ]
+        ]
+    ] = UNSET
+    r"""Allowed reasoning effort values for this model, in descending effort order (highest first). Null means no allowlist — all gateway effort values are accepted."""
+
+    supports_max_tokens: Optional[bool] = None
+    r"""Present and `true` when the model accepts `reasoning.max_tokens` in requests (Anthropic-style) instead of or in addition to `reasoning.effort`. Omitted otherwise."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = [
+            "default_effort",
+            "default_enabled",
+            "supported_efforts",
+            "supports_max_tokens",
+        ]
+        nullable_fields = ["default_effort", "supported_efforts"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/observabilityarizedestination.py b/src/openrouter/components/observabilityarizedestination.py
index 142a548b..fdcc98dd 100644
--- a/src/openrouter/components/observabilityarizedestination.py
+++ b/src/openrouter/components/observabilityarizedestination.py
@@ -15,6 +15,7 @@
 class ObservabilityArizeDestinationConfigTypedDict(TypedDict):
     api_key: str
     model_id: str
+    r"""The name of the tracing project in Arize AX"""
     space_key: str
     base_url: NotRequired[str]
     headers: NotRequired[Dict[str, str]]
@@ -25,6 +26,7 @@ class ObservabilityArizeDestinationConfig(BaseModel):
     api_key: Annotated[str, pydantic.Field(alias="apiKey")]
 
     model_id: Annotated[str, pydantic.Field(alias="modelId")]
+    r"""The name of the tracing project in Arize AX"""
 
     space_key: Annotated[str, pydantic.Field(alias="spaceKey")]
 
diff --git a/src/openrouter/components/rangecapability.py b/src/openrouter/components/rangecapability.py
new file mode 100644
index 00000000..76fabc08
--- /dev/null
+++ b/src/openrouter/components/rangecapability.py
@@ -0,0 +1,27 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel
+from typing import Literal
+from typing_extensions import TypedDict
+
+
+RangeCapabilityType = Literal["range",]
+
+
+class RangeCapabilityTypedDict(TypedDict):
+    r"""A parameter that accepts any value within an inclusive numeric range."""
+
+    max: float
+    min: float
+    type: RangeCapabilityType
+
+
+class RangeCapability(BaseModel):
+    r"""A parameter that accepts any value within an inclusive numeric range."""
+
+    max: float
+
+    min: float
+
+    type: RangeCapabilityType
diff --git a/src/openrouter/components/reasoningeffort.py b/src/openrouter/components/reasoningeffort.py
index 3cf5b2e3..fe3562c7 100644
--- a/src/openrouter/components/reasoningeffort.py
+++ b/src/openrouter/components/reasoningeffort.py
@@ -7,6 +7,7 @@
 
 ReasoningEffort = Union[
     Literal[
+        "max",
         "xhigh",
         "high",
         "medium",
diff --git a/src/openrouter/components/responsesrequest.py b/src/openrouter/components/responsesrequest.py
index 8f4b2a3e..683fab4a 100644
--- a/src/openrouter/components/responsesrequest.py
+++ b/src/openrouter/components/responsesrequest.py
@@ -16,6 +16,7 @@
 )
 from .autorouterplugin import AutoRouterPlugin, AutoRouterPluginTypedDict
 from .bashservertool import BashServerTool, BashServerToolTypedDict
+from .chatdebugoptions import ChatDebugOptions, ChatDebugOptionsTypedDict
 from .chatsearchmodelsservertool import (
     ChatSearchModelsServerTool,
     ChatSearchModelsServerToolTypedDict,
@@ -291,6 +292,8 @@ class ResponsesRequestTypedDict(TypedDict):
     background: NotRequired[Nullable[bool]]
     cache_control: NotRequired[AnthropicCacheControlDirectiveTypedDict]
     r"""Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models."""
+    debug: NotRequired[ChatDebugOptionsTypedDict]
+    r"""Debug options for inspecting request transformations (streaming only)"""
     frequency_penalty: NotRequired[Nullable[float]]
     image_config: NotRequired[Dict[str, ImageConfigTypedDict]]
     r"""Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details."""
@@ -348,6 +351,9 @@ class ResponsesRequest(BaseModel):
     cache_control: Optional[AnthropicCacheControlDirective] = None
     r"""Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models."""
 
+    debug: Optional[ChatDebugOptions] = None
+    r"""Debug options for inspecting request transformations (streaming only)"""
+
     frequency_penalty: OptionalNullable[float] = UNSET
 
     image_config: Optional[Dict[str, ImageConfig]] = None
@@ -448,6 +454,7 @@ def serialize_model(self, handler):
         optional_fields = [
             "background",
             "cache_control",
+            "debug",
             "frequency_penalty",
             "image_config",
             "include",
diff --git a/src/openrouter/components/streamevents.py b/src/openrouter/components/streamevents.py
index b1e1e147..0761a961 100644
--- a/src/openrouter/components/streamevents.py
+++ b/src/openrouter/components/streamevents.py
@@ -20,6 +20,7 @@
     CustomToolCallInputDoneEvent,
     CustomToolCallInputDoneEventTypedDict,
 )
+from .debugevent import DebugEvent, DebugEventTypedDict
 from .errorevent import ErrorEvent, ErrorEventTypedDict
 from .functioncallargsdeltaevent import (
     FunctionCallArgsDeltaEvent,
@@ -152,34 +153,35 @@
 StreamEventsTypedDict = TypeAliasType(
     "StreamEventsTypedDict",
     Union[
-        OpenResponsesCreatedEventTypedDict,
+        DebugEventTypedDict,
         OpenResponsesInProgressEventTypedDict,
         StreamEventsResponseCompletedTypedDict,
         StreamEventsResponseIncompleteTypedDict,
         StreamEventsResponseFailedTypedDict,
-        FusionCallInProgressEventTypedDict,
+        OpenResponsesCreatedEventTypedDict,
+        FusionCallCompletedEventTypedDict,
+        StreamEventsResponseOutputItemAddedTypedDict,
         WebSearchCallCompletedEventTypedDict,
         StreamEventsResponseOutputItemDoneTypedDict,
-        FusionCallCompletedEventTypedDict,
         ImageGenCallInProgressEventTypedDict,
-        StreamEventsResponseOutputItemAddedTypedDict,
-        ImageGenCallCompletedEventTypedDict,
         ImageGenCallGeneratingEventTypedDict,
+        ImageGenCallCompletedEventTypedDict,
+        FusionCallInProgressEventTypedDict,
         WebSearchCallInProgressEventTypedDict,
         WebSearchCallSearchingEventTypedDict,
-        FusionCallAnalysisInProgressEventTypedDict,
+        FusionCallPanelAddedEventTypedDict,
         CustomToolCallInputDoneEventTypedDict,
         CustomToolCallInputDeltaEventTypedDict,
-        FunctionCallArgsDeltaEventTypedDict,
         ApplyPatchCallOperationDiffDeltaEventTypedDict,
-        ErrorEventTypedDict,
+        FunctionCallArgsDeltaEventTypedDict,
         ApplyPatchCallOperationDiffDoneEventTypedDict,
-        FusionCallPanelAddedEventTypedDict,
+        FusionCallAnalysisInProgressEventTypedDict,
         FusionCallAnalysisCompletedEventTypedDict,
-        ReasoningSummaryPartDoneEventTypedDict,
-        RefusalDoneEventTypedDict,
+        ErrorEventTypedDict,
         ReasoningSummaryTextDoneEventTypedDict,
+        RefusalDoneEventTypedDict,
         ReasoningSummaryTextDeltaEventTypedDict,
+        ReasoningSummaryPartDoneEventTypedDict,
         ReasoningSummaryPartAddedEventTypedDict,
         ReasoningDoneEventTypedDict,
         ReasoningDeltaEventTypedDict,
@@ -187,13 +189,13 @@
         ContentPartAddedEventTypedDict,
         ImageGenCallPartialImageEventTypedDict,
         RefusalDeltaEventTypedDict,
-        ContentPartDoneEventTypedDict,
         FusionCallPanelDeltaEventTypedDict,
         FusionCallPanelReasoningDeltaEventTypedDict,
         FusionCallPanelCompletedEventTypedDict,
-        FusionCallPanelFailedEventTypedDict,
-        TextDeltaEventTypedDict,
+        ContentPartDoneEventTypedDict,
         TextDoneEventTypedDict,
+        TextDeltaEventTypedDict,
+        FusionCallPanelFailedEventTypedDict,
         AnnotationAddedEventTypedDict,
     ],
 )
@@ -221,6 +223,7 @@
         Annotated[
             CustomToolCallInputDoneEvent, Tag("response.custom_tool_call_input.done")
         ],
+        Annotated[DebugEvent, Tag("response.debug")],
         Annotated[StreamEventsResponseFailed, Tag("response.failed")],
         Annotated[
             FunctionCallArgsDeltaEvent, Tag("response.function_call_arguments.delta")
diff --git a/src/openrouter/components/subagentreasoning.py b/src/openrouter/components/subagentreasoning.py
index 1eb4e862..d2d50815 100644
--- a/src/openrouter/components/subagentreasoning.py
+++ b/src/openrouter/components/subagentreasoning.py
@@ -10,6 +10,7 @@
 
 SubagentReasoningEffort = Union[
     Literal[
+        "max",
         "xhigh",
         "high",
         "medium",
diff --git a/src/openrouter/components/benchmarkpricing.py b/src/openrouter/components/unifiedbenchmarkpricing.py
similarity index 87%
rename from src/openrouter/components/benchmarkpricing.py
rename to src/openrouter/components/unifiedbenchmarkpricing.py
index 3524f786..bad387ce 100644
--- a/src/openrouter/components/benchmarkpricing.py
+++ b/src/openrouter/components/unifiedbenchmarkpricing.py
@@ -5,7 +5,7 @@
 from typing_extensions import TypedDict
 
 
-class BenchmarkPricingTypedDict(TypedDict):
+class UnifiedBenchmarkPricingTypedDict(TypedDict):
     r"""OpenRouter pricing per token for this model. Null if pricing is unavailable."""
 
     completion: str
@@ -14,7 +14,7 @@ class BenchmarkPricingTypedDict(TypedDict):
     r"""Cost per input token (USD, decimal string)."""
 
 
-class BenchmarkPricing(BaseModel):
+class UnifiedBenchmarkPricing(BaseModel):
     r"""OpenRouter pricing per token for this model. Null if pricing is unavailable."""
 
     completion: str
diff --git a/src/openrouter/components/benchmarksaaitem.py b/src/openrouter/components/unifiedbenchmarksaaitem.py
similarity index 78%
rename from src/openrouter/components/benchmarksaaitem.py
rename to src/openrouter/components/unifiedbenchmarksaaitem.py
index 2855ffe1..a01518d4 100644
--- a/src/openrouter/components/benchmarksaaitem.py
+++ b/src/openrouter/components/unifiedbenchmarksaaitem.py
@@ -1,46 +1,59 @@
 """Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
 
 from __future__ import annotations
-from .benchmarkpricing import BenchmarkPricing, BenchmarkPricingTypedDict
+from .unifiedbenchmarkpricing import (
+    UnifiedBenchmarkPricing,
+    UnifiedBenchmarkPricingTypedDict,
+)
 from openrouter.types import BaseModel, Nullable, UNSET_SENTINEL
 from pydantic import model_serializer
+from typing import Literal
 from typing_extensions import TypedDict
 
 
-class BenchmarksAAItemTypedDict(TypedDict):
-    aa_name: str
-    r"""Model name as listed on Artificial Analysis."""
+UnifiedBenchmarksAAItemSource = Literal["artificial-analysis",]
+r"""Benchmark source discriminator."""
+
+
+class UnifiedBenchmarksAAItemTypedDict(TypedDict):
     agentic_index: Nullable[float]
     r"""Artificial Analysis Agentic Index composite score. Higher is better."""
     coding_index: Nullable[float]
     r"""Artificial Analysis Coding Index composite score. Higher is better."""
+    display_name: str
+    r"""Model name as listed on Artificial Analysis."""
     intelligence_index: Nullable[float]
     r"""Artificial Analysis Intelligence Index composite score. Higher is better."""
     model_permaslug: str
     r"""Stable OpenRouter model identifier."""
-    pricing: Nullable[BenchmarkPricingTypedDict]
+    pricing: Nullable[UnifiedBenchmarkPricingTypedDict]
     r"""OpenRouter pricing per token for this model. Null if pricing is unavailable."""
+    source: UnifiedBenchmarksAAItemSource
+    r"""Benchmark source discriminator."""
 
 
-class BenchmarksAAItem(BaseModel):
-    aa_name: str
-    r"""Model name as listed on Artificial Analysis."""
-
+class UnifiedBenchmarksAAItem(BaseModel):
     agentic_index: Nullable[float]
     r"""Artificial Analysis Agentic Index composite score. Higher is better."""
 
     coding_index: Nullable[float]
     r"""Artificial Analysis Coding Index composite score. Higher is better."""
 
+    display_name: str
+    r"""Model name as listed on Artificial Analysis."""
+
     intelligence_index: Nullable[float]
     r"""Artificial Analysis Intelligence Index composite score. Higher is better."""
 
     model_permaslug: str
     r"""Stable OpenRouter model identifier."""
 
-    pricing: Nullable[BenchmarkPricing]
+    pricing: Nullable[UnifiedBenchmarkPricing]
     r"""OpenRouter pricing per token for this model. Null if pricing is unavailable."""
 
+    source: UnifiedBenchmarksAAItemSource
+    r"""Benchmark source discriminator."""
+
     @model_serializer(mode="wrap")
     def serialize_model(self, handler):
         optional_fields = []
diff --git a/src/openrouter/components/benchmarksdaitem.py b/src/openrouter/components/unifiedbenchmarksdaitem.py
similarity index 83%
rename from src/openrouter/components/benchmarksdaitem.py
rename to src/openrouter/components/unifiedbenchmarksdaitem.py
index 7713e2e8..0bb8159d 100644
--- a/src/openrouter/components/benchmarksdaitem.py
+++ b/src/openrouter/components/unifiedbenchmarksdaitem.py
@@ -1,12 +1,20 @@
 """Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
 
 from __future__ import annotations
-from .benchmarkpricing import BenchmarkPricing, BenchmarkPricingTypedDict
+from .unifiedbenchmarkpricing import (
+    UnifiedBenchmarkPricing,
+    UnifiedBenchmarkPricingTypedDict,
+)
 from openrouter.types import BaseModel, Nullable, UNSET_SENTINEL
 from pydantic import model_serializer
+from typing import Literal
 from typing_extensions import TypedDict
 
 
+UnifiedBenchmarksDAItemSource = Literal["design-arena",]
+r"""Benchmark source discriminator."""
+
+
 class TournamentStatsTypedDict(TypedDict):
     r"""Placement distribution from tournament matches."""
 
@@ -67,7 +75,7 @@ def serialize_model(self, handler):
         return m
 
 
-class BenchmarksDAItemTypedDict(TypedDict):
+class UnifiedBenchmarksDAItemTypedDict(TypedDict):
     arena: str
     r"""Arena this ranking belongs to."""
     avg_generation_time_ms: Nullable[float]
@@ -79,16 +87,18 @@ class BenchmarksDAItemTypedDict(TypedDict):
     elo: float
     r"""ELO rating from head-to-head arena battles."""
     model_permaslug: str
-    r"""Stable OpenRouter model identifier when the model is on OpenRouter; otherwise the upstream Design Arena model id. Use pricing != null to detect OpenRouter-mapped models."""
-    pricing: Nullable[BenchmarkPricingTypedDict]
+    r"""Stable OpenRouter model identifier when mapped; otherwise the upstream Design Arena model id."""
+    pricing: Nullable[UnifiedBenchmarkPricingTypedDict]
     r"""OpenRouter pricing per token for this model. Null if pricing is unavailable."""
+    source: UnifiedBenchmarksDAItemSource
+    r"""Benchmark source discriminator."""
     tournament_stats: TournamentStatsTypedDict
     r"""Placement distribution from tournament matches."""
     win_rate: float
     r"""Win rate as a percentage (0–100)."""
 
 
-class BenchmarksDAItem(BaseModel):
+class UnifiedBenchmarksDAItem(BaseModel):
     arena: str
     r"""Arena this ranking belongs to."""
 
@@ -105,11 +115,14 @@ class BenchmarksDAItem(BaseModel):
     r"""ELO rating from head-to-head arena battles."""
 
     model_permaslug: str
-    r"""Stable OpenRouter model identifier when the model is on OpenRouter; otherwise the upstream Design Arena model id. Use pricing != null to detect OpenRouter-mapped models."""
+    r"""Stable OpenRouter model identifier when mapped; otherwise the upstream Design Arena model id."""
 
-    pricing: Nullable[BenchmarkPricing]
+    pricing: Nullable[UnifiedBenchmarkPricing]
     r"""OpenRouter pricing per token for this model. Null if pricing is unavailable."""
 
+    source: UnifiedBenchmarksDAItemSource
+    r"""Benchmark source discriminator."""
+
     tournament_stats: TournamentStats
     r"""Placement distribution from tournament matches."""
 
diff --git a/src/openrouter/components/unifiedbenchmarksmeta.py b/src/openrouter/components/unifiedbenchmarksmeta.py
new file mode 100644
index 00000000..6106104d
--- /dev/null
+++ b/src/openrouter/components/unifiedbenchmarksmeta.py
@@ -0,0 +1,95 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel, Nullable, UNSET_SENTINEL, UnrecognizedStr
+from openrouter.utils import validate_open_enum
+from pydantic import model_serializer
+from pydantic.functional_validators import PlainValidator
+from typing import Literal, Union
+from typing_extensions import Annotated, TypedDict
+
+
+UnifiedBenchmarksMetaSource = Union[
+    Literal[
+        "artificial-analysis",
+        "design-arena",
+    ],
+    UnrecognizedStr,
+]
+r"""The source filter applied, or null when all sources are returned."""
+
+
+UnifiedBenchmarksMetaVersion = Literal["v1",]
+r"""Dataset version."""
+
+
+class UnifiedBenchmarksMetaTypedDict(TypedDict):
+    as_of: str
+    r"""ISO-8601 timestamp of when this data was last updated."""
+    citation: Nullable[str]
+    r"""Required attribution when republishing this data, or null when results span multiple sources (attribute each item individually by its `source` discriminator)."""
+    model_count: int
+    r"""Number of unique models in the response."""
+    source: Nullable[UnifiedBenchmarksMetaSource]
+    r"""The source filter applied, or null when all sources are returned."""
+    source_url: Nullable[str]
+    r"""URL of the upstream data source, or null when results span multiple sources."""
+    task_type: Nullable[str]
+    r"""The task_type filter applied, or null if showing all."""
+    version: UnifiedBenchmarksMetaVersion
+    r"""Dataset version."""
+
+
+class UnifiedBenchmarksMeta(BaseModel):
+    as_of: str
+    r"""ISO-8601 timestamp of when this data was last updated."""
+
+    citation: Nullable[str]
+    r"""Required attribution when republishing this data, or null when results span multiple sources (attribute each item individually by its `source` discriminator)."""
+
+    model_count: int
+    r"""Number of unique models in the response."""
+
+    source: Annotated[
+        Nullable[UnifiedBenchmarksMetaSource], PlainValidator(validate_open_enum(False))
+    ]
+    r"""The source filter applied, or null when all sources are returned."""
+
+    source_url: Nullable[str]
+    r"""URL of the upstream data source, or null when results span multiple sources."""
+
+    task_type: Nullable[str]
+    r"""The task_type filter applied, or null if showing all."""
+
+    version: UnifiedBenchmarksMetaVersion
+    r"""Dataset version."""
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = []
+        nullable_fields = ["citation", "source", "source_url", "task_type"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
diff --git a/src/openrouter/components/unifiedbenchmarksresponse.py b/src/openrouter/components/unifiedbenchmarksresponse.py
new file mode 100644
index 00000000..8f064226
--- /dev/null
+++ b/src/openrouter/components/unifiedbenchmarksresponse.py
@@ -0,0 +1,43 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from .unifiedbenchmarksaaitem import (
+    UnifiedBenchmarksAAItem,
+    UnifiedBenchmarksAAItemTypedDict,
+)
+from .unifiedbenchmarksdaitem import (
+    UnifiedBenchmarksDAItem,
+    UnifiedBenchmarksDAItemTypedDict,
+)
+from .unifiedbenchmarksmeta import UnifiedBenchmarksMeta, UnifiedBenchmarksMetaTypedDict
+from openrouter.types import BaseModel
+from openrouter.utils import get_discriminator
+from pydantic import Discriminator, Tag
+from typing import List, Union
+from typing_extensions import Annotated, TypeAliasType, TypedDict
+
+
+UnifiedBenchmarksResponseDataTypedDict = TypeAliasType(
+    "UnifiedBenchmarksResponseDataTypedDict",
+    Union[UnifiedBenchmarksAAItemTypedDict, UnifiedBenchmarksDAItemTypedDict],
+)
+
+
+UnifiedBenchmarksResponseData = Annotated[
+    Union[
+        Annotated[UnifiedBenchmarksAAItem, Tag("artificial-analysis")],
+        Annotated[UnifiedBenchmarksDAItem, Tag("design-arena")],
+    ],
+    Discriminator(lambda m: get_discriminator(m, "source", "source")),
+]
+
+
+class UnifiedBenchmarksResponseTypedDict(TypedDict):
+    data: List[UnifiedBenchmarksResponseDataTypedDict]
+    meta: UnifiedBenchmarksMetaTypedDict
+
+
+class UnifiedBenchmarksResponse(BaseModel):
+    data: List[UnifiedBenchmarksResponseData]
+
+    meta: UnifiedBenchmarksMeta
diff --git a/src/openrouter/components/videogenerationrequest.py b/src/openrouter/components/videogenerationrequest.py
index ae3bd049..b755afef 100644
--- a/src/openrouter/components/videogenerationrequest.py
+++ b/src/openrouter/components/videogenerationrequest.py
@@ -11,7 +11,7 @@
 from typing_extensions import Annotated, NotRequired, TypedDict
 
 
-AspectRatio = Union[
+VideoGenerationRequestAspectRatio = Union[
     Literal[
         "16:9",
         "9:16",
@@ -28,7 +28,7 @@
 r"""Aspect ratio of the generated video"""
 
 
-class OptionsTypedDict(TypedDict):
+class VideoGenerationRequestOptionsTypedDict(TypedDict):
     r"""Provider-specific options keyed by provider slug. Only options for the matched provider are forwarded; the rest are ignored. Unrecognized keys are silently dropped."""
 
     oneai: NotRequired[Dict[str, Nullable[Any]]]
@@ -148,7 +148,7 @@ class OptionsTypedDict(TypedDict):
     z_ai: NotRequired[Dict[str, Nullable[Any]]]
 
 
-class Options(BaseModel):
+class VideoGenerationRequestOptions(BaseModel):
     r"""Provider-specific options keyed by provider slug. Only options for the matched provider are forwarded; the rest are ignored. Unrecognized keys are silently dropped."""
 
     oneai: Annotated[
@@ -429,16 +429,16 @@ class Options(BaseModel):
 class VideoGenerationRequestProviderTypedDict(TypedDict):
     r"""Provider-specific passthrough configuration"""
 
-    options: NotRequired[OptionsTypedDict]
+    options: NotRequired[VideoGenerationRequestOptionsTypedDict]
 
 
 class VideoGenerationRequestProvider(BaseModel):
     r"""Provider-specific passthrough configuration"""
 
-    options: Optional[Options] = None
+    options: Optional[VideoGenerationRequestOptions] = None
 
 
-Resolution = Union[
+VideoGenerationRequestResolution = Union[
     Literal[
         "480p",
         "720p",
@@ -455,7 +455,7 @@ class VideoGenerationRequestProvider(BaseModel):
 class VideoGenerationRequestTypedDict(TypedDict):
     model: str
     prompt: str
-    aspect_ratio: NotRequired[AspectRatio]
+    aspect_ratio: NotRequired[VideoGenerationRequestAspectRatio]
     r"""Aspect ratio of the generated video"""
     callback_url: NotRequired[str]
     r"""URL to receive a webhook notification when the video generation job completes. Overrides the workspace-level default callback URL if set. Must be HTTPS."""
@@ -469,7 +469,7 @@ class VideoGenerationRequestTypedDict(TypedDict):
     r"""Reference assets to guide video generation. Accepts image, audio, and video references. Audio and video references are only honored by providers that support them (currently BytePlus Seedance 2.0); other providers use image references and ignore the rest."""
     provider: NotRequired[VideoGenerationRequestProviderTypedDict]
     r"""Provider-specific passthrough configuration"""
-    resolution: NotRequired[Resolution]
+    resolution: NotRequired[VideoGenerationRequestResolution]
     r"""Resolution of the generated video"""
     seed: NotRequired[int]
     r"""If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers."""
@@ -483,7 +483,8 @@ class VideoGenerationRequest(BaseModel):
     prompt: str
 
     aspect_ratio: Annotated[
-        Optional[AspectRatio], PlainValidator(validate_open_enum(False))
+        Optional[VideoGenerationRequestAspectRatio],
+        PlainValidator(validate_open_enum(False)),
     ] = None
     r"""Aspect ratio of the generated video"""
 
@@ -506,7 +507,8 @@ class VideoGenerationRequest(BaseModel):
     r"""Provider-specific passthrough configuration"""
 
     resolution: Annotated[
-        Optional[Resolution], PlainValidator(validate_open_enum(False))
+        Optional[VideoGenerationRequestResolution],
+        PlainValidator(validate_open_enum(False)),
     ] = None
     r"""Resolution of the generated video"""
 
diff --git a/src/openrouter/datasets.py b/src/openrouter/datasets.py
index c80a941f..c4839125 100644
--- a/src/openrouter/datasets.py
+++ b/src/openrouter/datasets.py
@@ -426,542 +426,6 @@ async def empty_result():
 
         raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
 
-    def get_benchmarks_artificial_analysis(
-        self,
-        *,
-        http_referer: Optional[str] = None,
-        x_open_router_title: Optional[str] = None,
-        x_open_router_categories: Optional[str] = None,
-        max_results: Optional[int] = 50,
-        retries: OptionalNullable[utils.RetryConfig] = UNSET,
-        server_url: Optional[str] = None,
-        timeout_ms: Optional[int] = None,
-        http_headers: Optional[Mapping[str, str]] = None,
-    ) -> components.BenchmarksAAResponse:
-        r"""Artificial Analysis Benchmark Indices
-
-        Returns composite index scores (Intelligence, Coding, Agentic) from Artificial Analysis for LLM models. Includes OpenRouter pricing per model. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
-
-        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
-            This is used to track API usage per application.
-
-        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
-
-        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
-
-        :param max_results: Max results to return (1–100, default 50).
-        :param retries: Override the default retry configuration for this method
-        :param server_url: Override the default server URL for this method
-        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
-        :param http_headers: Additional headers to set or replace on requests.
-        """
-        base_url = None
-        url_variables = None
-        if timeout_ms is None:
-            timeout_ms = self.sdk_configuration.timeout_ms
-
-        if server_url is not None:
-            base_url = server_url
-        else:
-            base_url = self._get_url(base_url, url_variables)
-
-        request = operations.GetBenchmarksArtificialAnalysisRequest(
-            http_referer=http_referer,
-            x_open_router_title=x_open_router_title,
-            x_open_router_categories=x_open_router_categories,
-            max_results=max_results,
-        )
-
-        req = self._build_request(
-            method="GET",
-            path="/datasets/benchmarks/artificial-analysis",
-            base_url=base_url,
-            url_variables=url_variables,
-            request=request,
-            request_body_required=False,
-            request_has_path_params=False,
-            request_has_query_params=True,
-            user_agent_header="user-agent",
-            accept_header_value="application/json",
-            http_headers=http_headers,
-            _globals=operations.GetBenchmarksArtificialAnalysisGlobals(
-                http_referer=self.sdk_configuration.globals.http_referer,
-                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
-                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
-            ),
-            security=self.sdk_configuration.security,
-            allow_empty_value=None,
-            timeout_ms=timeout_ms,
-        )
-
-        if retries == UNSET:
-            if self.sdk_configuration.retry_config is not UNSET:
-                retries = self.sdk_configuration.retry_config
-            else:
-                retries = utils.RetryConfig(
-                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
-                )
-
-        retry_config = None
-        if isinstance(retries, utils.RetryConfig):
-            retry_config = (retries, ["5XX"])
-
-        http_res = self.do_request(
-            hook_ctx=HookContext(
-                config=self.sdk_configuration,
-                base_url=base_url or "",
-                operation_id="getBenchmarksArtificialAnalysis",
-                oauth2_scopes=None,
-                security_source=get_security_from_env(
-                    self.sdk_configuration.security, components.Security
-                ),
-            ),
-            request=req,
-            error_status_codes=["400", "401", "429", "4XX", "500", "5XX"],
-            retry_config=retry_config,
-        )
-
-        response_data: Any = None
-        if utils.match_response(http_res, "200", "application/json"):
-            return unmarshal_json_response(components.BenchmarksAAResponse, http_res)
-        if utils.match_response(http_res, "400", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.BadRequestResponseErrorData, http_res
-            )
-            raise errors.BadRequestResponseError(response_data, http_res)
-        if utils.match_response(http_res, "401", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.UnauthorizedResponseErrorData, http_res
-            )
-            raise errors.UnauthorizedResponseError(response_data, http_res)
-        if utils.match_response(http_res, "429", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.TooManyRequestsResponseErrorData, http_res
-            )
-            raise errors.TooManyRequestsResponseError(response_data, http_res)
-        if utils.match_response(http_res, "500", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.InternalServerResponseErrorData, http_res
-            )
-            raise errors.InternalServerResponseError(response_data, http_res)
-        if utils.match_response(http_res, "4XX", "*"):
-            http_res_text = utils.stream_to_text(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-        if utils.match_response(http_res, "5XX", "*"):
-            http_res_text = utils.stream_to_text(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-
-        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
-
-    async def get_benchmarks_artificial_analysis_async(
-        self,
-        *,
-        http_referer: Optional[str] = None,
-        x_open_router_title: Optional[str] = None,
-        x_open_router_categories: Optional[str] = None,
-        max_results: Optional[int] = 50,
-        retries: OptionalNullable[utils.RetryConfig] = UNSET,
-        server_url: Optional[str] = None,
-        timeout_ms: Optional[int] = None,
-        http_headers: Optional[Mapping[str, str]] = None,
-    ) -> components.BenchmarksAAResponse:
-        r"""Artificial Analysis Benchmark Indices
-
-        Returns composite index scores (Intelligence, Coding, Agentic) from Artificial Analysis for LLM models. Includes OpenRouter pricing per model. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
-
-        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
-            This is used to track API usage per application.
-
-        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
-
-        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
-
-        :param max_results: Max results to return (1–100, default 50).
-        :param retries: Override the default retry configuration for this method
-        :param server_url: Override the default server URL for this method
-        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
-        :param http_headers: Additional headers to set or replace on requests.
-        """
-        base_url = None
-        url_variables = None
-        if timeout_ms is None:
-            timeout_ms = self.sdk_configuration.timeout_ms
-
-        if server_url is not None:
-            base_url = server_url
-        else:
-            base_url = self._get_url(base_url, url_variables)
-
-        request = operations.GetBenchmarksArtificialAnalysisRequest(
-            http_referer=http_referer,
-            x_open_router_title=x_open_router_title,
-            x_open_router_categories=x_open_router_categories,
-            max_results=max_results,
-        )
-
-        req = self._build_request_async(
-            method="GET",
-            path="/datasets/benchmarks/artificial-analysis",
-            base_url=base_url,
-            url_variables=url_variables,
-            request=request,
-            request_body_required=False,
-            request_has_path_params=False,
-            request_has_query_params=True,
-            user_agent_header="user-agent",
-            accept_header_value="application/json",
-            http_headers=http_headers,
-            _globals=operations.GetBenchmarksArtificialAnalysisGlobals(
-                http_referer=self.sdk_configuration.globals.http_referer,
-                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
-                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
-            ),
-            security=self.sdk_configuration.security,
-            allow_empty_value=None,
-            timeout_ms=timeout_ms,
-        )
-
-        if retries == UNSET:
-            if self.sdk_configuration.retry_config is not UNSET:
-                retries = self.sdk_configuration.retry_config
-            else:
-                retries = utils.RetryConfig(
-                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
-                )
-
-        retry_config = None
-        if isinstance(retries, utils.RetryConfig):
-            retry_config = (retries, ["5XX"])
-
-        http_res = await self.do_request_async(
-            hook_ctx=HookContext(
-                config=self.sdk_configuration,
-                base_url=base_url or "",
-                operation_id="getBenchmarksArtificialAnalysis",
-                oauth2_scopes=None,
-                security_source=get_security_from_env(
-                    self.sdk_configuration.security, components.Security
-                ),
-            ),
-            request=req,
-            error_status_codes=["400", "401", "429", "4XX", "500", "5XX"],
-            retry_config=retry_config,
-        )
-
-        response_data: Any = None
-        if utils.match_response(http_res, "200", "application/json"):
-            return unmarshal_json_response(components.BenchmarksAAResponse, http_res)
-        if utils.match_response(http_res, "400", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.BadRequestResponseErrorData, http_res
-            )
-            raise errors.BadRequestResponseError(response_data, http_res)
-        if utils.match_response(http_res, "401", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.UnauthorizedResponseErrorData, http_res
-            )
-            raise errors.UnauthorizedResponseError(response_data, http_res)
-        if utils.match_response(http_res, "429", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.TooManyRequestsResponseErrorData, http_res
-            )
-            raise errors.TooManyRequestsResponseError(response_data, http_res)
-        if utils.match_response(http_res, "500", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.InternalServerResponseErrorData, http_res
-            )
-            raise errors.InternalServerResponseError(response_data, http_res)
-        if utils.match_response(http_res, "4XX", "*"):
-            http_res_text = await utils.stream_to_text_async(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-        if utils.match_response(http_res, "5XX", "*"):
-            http_res_text = await utils.stream_to_text_async(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-
-        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
-
-    def get_benchmarks_design_arena(
-        self,
-        *,
-        http_referer: Optional[str] = None,
-        x_open_router_title: Optional[str] = None,
-        x_open_router_categories: Optional[str] = None,
-        arena: Optional[operations.Arena] = "models",
-        category: Optional[str] = None,
-        max_results: Optional[int] = 50,
-        retries: OptionalNullable[utils.RetryConfig] = UNSET,
-        server_url: Optional[str] = None,
-        timeout_ms: Optional[int] = None,
-        http_headers: Optional[Mapping[str, str]] = None,
-    ) -> components.BenchmarksDAResponse:
-        r"""Design Arena Benchmark Rankings
-
-        Returns ELO ratings from head-to-head arena battles on Design Arena. Filterable by arena (models/builders/agents) and category. Includes OpenRouter pricing per model. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
-
-        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
-            This is used to track API usage per application.
-
-        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
-
-        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
-
-        :param arena: Arena to query. Defaults to `models`.
-        :param category: Category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
-        :param max_results: Max results to return: per category when no category filter is applied (1–100, default 50).
-        :param retries: Override the default retry configuration for this method
-        :param server_url: Override the default server URL for this method
-        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
-        :param http_headers: Additional headers to set or replace on requests.
-        """
-        base_url = None
-        url_variables = None
-        if timeout_ms is None:
-            timeout_ms = self.sdk_configuration.timeout_ms
-
-        if server_url is not None:
-            base_url = server_url
-        else:
-            base_url = self._get_url(base_url, url_variables)
-
-        request = operations.GetBenchmarksDesignArenaRequest(
-            http_referer=http_referer,
-            x_open_router_title=x_open_router_title,
-            x_open_router_categories=x_open_router_categories,
-            arena=arena,
-            category=category,
-            max_results=max_results,
-        )
-
-        req = self._build_request(
-            method="GET",
-            path="/datasets/benchmarks/design-arena",
-            base_url=base_url,
-            url_variables=url_variables,
-            request=request,
-            request_body_required=False,
-            request_has_path_params=False,
-            request_has_query_params=True,
-            user_agent_header="user-agent",
-            accept_header_value="application/json",
-            http_headers=http_headers,
-            _globals=operations.GetBenchmarksDesignArenaGlobals(
-                http_referer=self.sdk_configuration.globals.http_referer,
-                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
-                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
-            ),
-            security=self.sdk_configuration.security,
-            allow_empty_value=None,
-            timeout_ms=timeout_ms,
-        )
-
-        if retries == UNSET:
-            if self.sdk_configuration.retry_config is not UNSET:
-                retries = self.sdk_configuration.retry_config
-            else:
-                retries = utils.RetryConfig(
-                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
-                )
-
-        retry_config = None
-        if isinstance(retries, utils.RetryConfig):
-            retry_config = (retries, ["5XX"])
-
-        http_res = self.do_request(
-            hook_ctx=HookContext(
-                config=self.sdk_configuration,
-                base_url=base_url or "",
-                operation_id="getBenchmarksDesignArena",
-                oauth2_scopes=None,
-                security_source=get_security_from_env(
-                    self.sdk_configuration.security, components.Security
-                ),
-            ),
-            request=req,
-            error_status_codes=["400", "401", "429", "4XX", "500", "5XX"],
-            retry_config=retry_config,
-        )
-
-        response_data: Any = None
-        if utils.match_response(http_res, "200", "application/json"):
-            return unmarshal_json_response(components.BenchmarksDAResponse, http_res)
-        if utils.match_response(http_res, "400", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.BadRequestResponseErrorData, http_res
-            )
-            raise errors.BadRequestResponseError(response_data, http_res)
-        if utils.match_response(http_res, "401", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.UnauthorizedResponseErrorData, http_res
-            )
-            raise errors.UnauthorizedResponseError(response_data, http_res)
-        if utils.match_response(http_res, "429", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.TooManyRequestsResponseErrorData, http_res
-            )
-            raise errors.TooManyRequestsResponseError(response_data, http_res)
-        if utils.match_response(http_res, "500", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.InternalServerResponseErrorData, http_res
-            )
-            raise errors.InternalServerResponseError(response_data, http_res)
-        if utils.match_response(http_res, "4XX", "*"):
-            http_res_text = utils.stream_to_text(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-        if utils.match_response(http_res, "5XX", "*"):
-            http_res_text = utils.stream_to_text(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-
-        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
-
-    async def get_benchmarks_design_arena_async(
-        self,
-        *,
-        http_referer: Optional[str] = None,
-        x_open_router_title: Optional[str] = None,
-        x_open_router_categories: Optional[str] = None,
-        arena: Optional[operations.Arena] = "models",
-        category: Optional[str] = None,
-        max_results: Optional[int] = 50,
-        retries: OptionalNullable[utils.RetryConfig] = UNSET,
-        server_url: Optional[str] = None,
-        timeout_ms: Optional[int] = None,
-        http_headers: Optional[Mapping[str, str]] = None,
-    ) -> components.BenchmarksDAResponse:
-        r"""Design Arena Benchmark Rankings
-
-        Returns ELO ratings from head-to-head arena battles on Design Arena. Filterable by arena (models/builders/agents) and category. Includes OpenRouter pricing per model. Authenticate with any valid OpenRouter API key. Rate-limited to 30 requests/minute per key and 500 requests/day per account.
-
-        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
-            This is used to track API usage per application.
-
-        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
-
-        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
-
-        :param arena: Arena to query. Defaults to `models`.
-        :param category: Category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories.
-        :param max_results: Max results to return: per category when no category filter is applied (1–100, default 50).
-        :param retries: Override the default retry configuration for this method
-        :param server_url: Override the default server URL for this method
-        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
-        :param http_headers: Additional headers to set or replace on requests.
-        """
-        base_url = None
-        url_variables = None
-        if timeout_ms is None:
-            timeout_ms = self.sdk_configuration.timeout_ms
-
-        if server_url is not None:
-            base_url = server_url
-        else:
-            base_url = self._get_url(base_url, url_variables)
-
-        request = operations.GetBenchmarksDesignArenaRequest(
-            http_referer=http_referer,
-            x_open_router_title=x_open_router_title,
-            x_open_router_categories=x_open_router_categories,
-            arena=arena,
-            category=category,
-            max_results=max_results,
-        )
-
-        req = self._build_request_async(
-            method="GET",
-            path="/datasets/benchmarks/design-arena",
-            base_url=base_url,
-            url_variables=url_variables,
-            request=request,
-            request_body_required=False,
-            request_has_path_params=False,
-            request_has_query_params=True,
-            user_agent_header="user-agent",
-            accept_header_value="application/json",
-            http_headers=http_headers,
-            _globals=operations.GetBenchmarksDesignArenaGlobals(
-                http_referer=self.sdk_configuration.globals.http_referer,
-                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
-                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
-            ),
-            security=self.sdk_configuration.security,
-            allow_empty_value=None,
-            timeout_ms=timeout_ms,
-        )
-
-        if retries == UNSET:
-            if self.sdk_configuration.retry_config is not UNSET:
-                retries = self.sdk_configuration.retry_config
-            else:
-                retries = utils.RetryConfig(
-                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
-                )
-
-        retry_config = None
-        if isinstance(retries, utils.RetryConfig):
-            retry_config = (retries, ["5XX"])
-
-        http_res = await self.do_request_async(
-            hook_ctx=HookContext(
-                config=self.sdk_configuration,
-                base_url=base_url or "",
-                operation_id="getBenchmarksDesignArena",
-                oauth2_scopes=None,
-                security_source=get_security_from_env(
-                    self.sdk_configuration.security, components.Security
-                ),
-            ),
-            request=req,
-            error_status_codes=["400", "401", "429", "4XX", "500", "5XX"],
-            retry_config=retry_config,
-        )
-
-        response_data: Any = None
-        if utils.match_response(http_res, "200", "application/json"):
-            return unmarshal_json_response(components.BenchmarksDAResponse, http_res)
-        if utils.match_response(http_res, "400", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.BadRequestResponseErrorData, http_res
-            )
-            raise errors.BadRequestResponseError(response_data, http_res)
-        if utils.match_response(http_res, "401", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.UnauthorizedResponseErrorData, http_res
-            )
-            raise errors.UnauthorizedResponseError(response_data, http_res)
-        if utils.match_response(http_res, "429", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.TooManyRequestsResponseErrorData, http_res
-            )
-            raise errors.TooManyRequestsResponseError(response_data, http_res)
-        if utils.match_response(http_res, "500", "application/json"):
-            response_data = unmarshal_json_response(
-                errors.InternalServerResponseErrorData, http_res
-            )
-            raise errors.InternalServerResponseError(response_data, http_res)
-        if utils.match_response(http_res, "4XX", "*"):
-            http_res_text = await utils.stream_to_text_async(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-        if utils.match_response(http_res, "5XX", "*"):
-            http_res_text = await utils.stream_to_text_async(http_res)
-            raise errors.OpenRouterDefaultError(
-                "API error occurred", http_res, http_res_text
-            )
-
-        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
-
     def get_rankings_daily(
         self,
         *,
diff --git a/src/openrouter/images.py b/src/openrouter/images.py
new file mode 100644
index 00000000..87b2682c
--- /dev/null
+++ b/src/openrouter/images.py
@@ -0,0 +1,1319 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from .basesdk import BaseSDK
+from enum import Enum
+from openrouter import components, errors, operations, utils
+from openrouter._hooks import HookContext
+from openrouter.types import OptionalNullable, UNSET
+from openrouter.utils import eventstreaming, get_security_from_env
+from openrouter.utils.unmarshal_json_response import unmarshal_json_response
+from typing import Any, List, Literal, Mapping, Optional, Union, overload
+
+
+class GenerateAcceptEnum(str, Enum):
+    APPLICATION_JSON = "application/json"
+    TEXT_EVENT_STREAM = "text/event-stream"
+
+
+class Images(BaseSDK):
+    r"""Images endpoints"""
+
+    @overload
+    def generate(
+        self,
+        *,
+        model: str,
+        prompt: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        aspect_ratio: Optional[components.ImageGenerationRequestAspectRatio] = None,
+        background: Optional[components.ImageGenerationRequestBackground] = None,
+        input_references: Optional[
+            Union[
+                List[components.ContentPartImage],
+                List[components.ContentPartImageTypedDict],
+            ]
+        ] = None,
+        n: Optional[int] = None,
+        output_compression: Optional[int] = None,
+        output_format: Optional[components.ImageGenerationRequestOutputFormat] = None,
+        provider: Optional[
+            Union[
+                components.ImageGenerationRequestProvider,
+                components.ImageGenerationRequestProviderTypedDict,
+            ]
+        ] = None,
+        quality: Optional[components.ImageGenerationRequestQuality] = None,
+        resolution: Optional[components.ImageGenerationRequestResolution] = None,
+        seed: Optional[int] = None,
+        size: Optional[str] = None,
+        stream: Union[Literal[False], None] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.ImageGenerationResponse:
+        r"""Generate an image
+
+        Generates an image from a text prompt via the image generation router
+
+        :param model: The image generation model to use
+        :param prompt: Text description of the desired image
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param aspect_ratio: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+        :param background: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+        :param input_references: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+        :param n: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+        :param output_compression: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+        :param output_format: Encoding of the returned image bytes.
+        :param provider: Provider-specific passthrough configuration
+        :param quality: Rendering quality. Providers without a quality knob ignore this.
+        :param resolution: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+        :param seed: If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+        :param size: Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+        :param stream: If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param accept_header_override: Override the default accept header for this method
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+
+    @overload
+    def generate(
+        self,
+        *,
+        model: str,
+        prompt: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        aspect_ratio: Optional[components.ImageGenerationRequestAspectRatio] = None,
+        background: Optional[components.ImageGenerationRequestBackground] = None,
+        input_references: Optional[
+            Union[
+                List[components.ContentPartImage],
+                List[components.ContentPartImageTypedDict],
+            ]
+        ] = None,
+        n: Optional[int] = None,
+        output_compression: Optional[int] = None,
+        output_format: Optional[components.ImageGenerationRequestOutputFormat] = None,
+        provider: Optional[
+            Union[
+                components.ImageGenerationRequestProvider,
+                components.ImageGenerationRequestProviderTypedDict,
+            ]
+        ] = None,
+        quality: Optional[components.ImageGenerationRequestQuality] = None,
+        resolution: Optional[components.ImageGenerationRequestResolution] = None,
+        seed: Optional[int] = None,
+        size: Optional[str] = None,
+        stream: Literal[True],
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> eventstreaming.EventStream[components.ImageStreamingResponseData]:
+        r"""Generate an image
+
+        Generates an image from a text prompt via the image generation router
+
+        :param model: The image generation model to use
+        :param prompt: Text description of the desired image
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param aspect_ratio: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+        :param background: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+        :param input_references: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+        :param n: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+        :param output_compression: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+        :param output_format: Encoding of the returned image bytes.
+        :param provider: Provider-specific passthrough configuration
+        :param quality: Rendering quality. Providers without a quality knob ignore this.
+        :param resolution: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+        :param seed: If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+        :param size: Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+        :param stream: If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param accept_header_override: Override the default accept header for this method
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+
+    def generate(
+        self,
+        *,
+        model: str,
+        prompt: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        aspect_ratio: Optional[components.ImageGenerationRequestAspectRatio] = None,
+        background: Optional[components.ImageGenerationRequestBackground] = None,
+        input_references: Optional[
+            Union[
+                List[components.ContentPartImage],
+                List[components.ContentPartImageTypedDict],
+            ]
+        ] = None,
+        n: Optional[int] = None,
+        output_compression: Optional[int] = None,
+        output_format: Optional[components.ImageGenerationRequestOutputFormat] = None,
+        provider: Optional[
+            Union[
+                components.ImageGenerationRequestProvider,
+                components.ImageGenerationRequestProviderTypedDict,
+            ]
+        ] = None,
+        quality: Optional[components.ImageGenerationRequestQuality] = None,
+        resolution: Optional[components.ImageGenerationRequestResolution] = None,
+        seed: Optional[int] = None,
+        size: Optional[str] = None,
+        stream: Optional[bool] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> operations.CreateImagesResponse:
+        r"""Generate an image
+
+        Generates an image from a text prompt via the image generation router
+
+        :param model: The image generation model to use
+        :param prompt: Text description of the desired image
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param aspect_ratio: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+        :param background: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+        :param input_references: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+        :param n: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+        :param output_compression: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+        :param output_format: Encoding of the returned image bytes.
+        :param provider: Provider-specific passthrough configuration
+        :param quality: Rendering quality. Providers without a quality knob ignore this.
+        :param resolution: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+        :param seed: If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+        :param size: Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+        :param stream: If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param accept_header_override: Override the default accept header for this method
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.CreateImagesRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+            image_generation_request=components.ImageGenerationRequest(
+                aspect_ratio=aspect_ratio,
+                background=background,
+                input_references=utils.get_pydantic_model(
+                    input_references, Optional[List[components.ContentPartImage]]
+                ),
+                model=model,
+                n=n,
+                output_compression=output_compression,
+                output_format=output_format,
+                prompt=prompt,
+                provider=utils.get_pydantic_model(
+                    provider, Optional[components.ImageGenerationRequestProvider]
+                ),
+                quality=quality,
+                resolution=resolution,
+                seed=seed,
+                size=size,
+                stream=stream,
+            ),
+        )
+
+        req = self._build_request(
+            method="POST",
+            path="/images",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=True,
+            request_has_path_params=False,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="text/event-stream" if stream else "application/json",
+            http_headers=http_headers,
+            _globals=operations.CreateImagesGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            get_serialized_body=lambda: utils.serialize_request_body(
+                request.image_generation_request,
+                False,
+                False,
+                "json",
+                components.ImageGenerationRequest,
+            ),
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = self.do_request(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="createImages",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=[
+                "400",
+                "401",
+                "402",
+                "403",
+                "404",
+                "429",
+                "4XX",
+                "500",
+                "502",
+                "524",
+                "529",
+                "5XX",
+            ],
+            stream=True,
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            return unmarshal_json_response(
+                components.ImageGenerationResponse, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "200", "text/event-stream"):
+            return eventstreaming.EventStream(
+                http_res,
+                lambda raw: utils.unmarshal_json(
+                    raw, components.ImageStreamingResponse
+                ).data,
+                sentinel="[DONE]",
+                client_ref=self,
+            )
+        if utils.match_response(http_res, "400", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.BadRequestResponseErrorData, http_res, http_res_text
+            )
+            raise errors.BadRequestResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "401", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.UnauthorizedResponseErrorData, http_res, http_res_text
+            )
+            raise errors.UnauthorizedResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "402", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.PaymentRequiredResponseErrorData, http_res, http_res_text
+            )
+            raise errors.PaymentRequiredResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "403", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.ForbiddenResponseErrorData, http_res, http_res_text
+            )
+            raise errors.ForbiddenResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "404", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.NotFoundResponseErrorData, http_res, http_res_text
+            )
+            raise errors.NotFoundResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "429", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.TooManyRequestsResponseErrorData, http_res, http_res_text
+            )
+            raise errors.TooManyRequestsResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "500", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res, http_res_text
+            )
+            raise errors.InternalServerResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "502", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.BadGatewayResponseErrorData, http_res, http_res_text
+            )
+            raise errors.BadGatewayResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "524", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.EdgeNetworkTimeoutResponseErrorData, http_res, http_res_text
+            )
+            raise errors.EdgeNetworkTimeoutResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "529", "application/json"):
+            http_res_text = utils.stream_to_text(http_res)
+            response_data = unmarshal_json_response(
+                errors.ProviderOverloadedResponseErrorData, http_res, http_res_text
+            )
+            raise errors.ProviderOverloadedResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        http_res_text = utils.stream_to_text(http_res)
+        raise errors.OpenRouterDefaultError(
+            "Unexpected response received", http_res, http_res_text
+        )
+
+    @overload
+    async def generate_async(
+        self,
+        *,
+        model: str,
+        prompt: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        aspect_ratio: Optional[components.ImageGenerationRequestAspectRatio] = None,
+        background: Optional[components.ImageGenerationRequestBackground] = None,
+        input_references: Optional[
+            Union[
+                List[components.ContentPartImage],
+                List[components.ContentPartImageTypedDict],
+            ]
+        ] = None,
+        n: Optional[int] = None,
+        output_compression: Optional[int] = None,
+        output_format: Optional[components.ImageGenerationRequestOutputFormat] = None,
+        provider: Optional[
+            Union[
+                components.ImageGenerationRequestProvider,
+                components.ImageGenerationRequestProviderTypedDict,
+            ]
+        ] = None,
+        quality: Optional[components.ImageGenerationRequestQuality] = None,
+        resolution: Optional[components.ImageGenerationRequestResolution] = None,
+        seed: Optional[int] = None,
+        size: Optional[str] = None,
+        stream: Union[Literal[False], None] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.ImageGenerationResponse:
+        r"""Generate an image
+
+        Generates an image from a text prompt via the image generation router
+
+        :param model: The image generation model to use
+        :param prompt: Text description of the desired image
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param aspect_ratio: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+        :param background: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+        :param input_references: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+        :param n: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+        :param output_compression: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+        :param output_format: Encoding of the returned image bytes.
+        :param provider: Provider-specific passthrough configuration
+        :param quality: Rendering quality. Providers without a quality knob ignore this.
+        :param resolution: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+        :param seed: If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+        :param size: Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+        :param stream: If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param accept_header_override: Override the default accept header for this method
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+
+    @overload
+    async def generate_async(
+        self,
+        *,
+        model: str,
+        prompt: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        aspect_ratio: Optional[components.ImageGenerationRequestAspectRatio] = None,
+        background: Optional[components.ImageGenerationRequestBackground] = None,
+        input_references: Optional[
+            Union[
+                List[components.ContentPartImage],
+                List[components.ContentPartImageTypedDict],
+            ]
+        ] = None,
+        n: Optional[int] = None,
+        output_compression: Optional[int] = None,
+        output_format: Optional[components.ImageGenerationRequestOutputFormat] = None,
+        provider: Optional[
+            Union[
+                components.ImageGenerationRequestProvider,
+                components.ImageGenerationRequestProviderTypedDict,
+            ]
+        ] = None,
+        quality: Optional[components.ImageGenerationRequestQuality] = None,
+        resolution: Optional[components.ImageGenerationRequestResolution] = None,
+        seed: Optional[int] = None,
+        size: Optional[str] = None,
+        stream: Literal[True],
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> eventstreaming.EventStreamAsync[components.ImageStreamingResponseData]:
+        r"""Generate an image
+
+        Generates an image from a text prompt via the image generation router
+
+        :param model: The image generation model to use
+        :param prompt: Text description of the desired image
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param aspect_ratio: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+        :param background: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+        :param input_references: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+        :param n: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+        :param output_compression: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+        :param output_format: Encoding of the returned image bytes.
+        :param provider: Provider-specific passthrough configuration
+        :param quality: Rendering quality. Providers without a quality knob ignore this.
+        :param resolution: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+        :param seed: If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+        :param size: Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+        :param stream: If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param accept_header_override: Override the default accept header for this method
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+
+    async def generate_async(
+        self,
+        *,
+        model: str,
+        prompt: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        aspect_ratio: Optional[components.ImageGenerationRequestAspectRatio] = None,
+        background: Optional[components.ImageGenerationRequestBackground] = None,
+        input_references: Optional[
+            Union[
+                List[components.ContentPartImage],
+                List[components.ContentPartImageTypedDict],
+            ]
+        ] = None,
+        n: Optional[int] = None,
+        output_compression: Optional[int] = None,
+        output_format: Optional[components.ImageGenerationRequestOutputFormat] = None,
+        provider: Optional[
+            Union[
+                components.ImageGenerationRequestProvider,
+                components.ImageGenerationRequestProviderTypedDict,
+            ]
+        ] = None,
+        quality: Optional[components.ImageGenerationRequestQuality] = None,
+        resolution: Optional[components.ImageGenerationRequestResolution] = None,
+        seed: Optional[int] = None,
+        size: Optional[str] = None,
+        stream: Optional[bool] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> operations.CreateImagesResponse:
+        r"""Generate an image
+
+        Generates an image from a text prompt via the image generation router
+
+        :param model: The image generation model to use
+        :param prompt: Text description of the desired image
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param aspect_ratio: Normalized aspect ratio of the generated image. Providers clamp to their supported subset.
+        :param background: Background treatment. `transparent` requires an output_format that supports alpha (png or webp).
+        :param input_references: Reference images to guide image-to-image generation, as base64 data URLs or HTTP(S) URLs.
+        :param n: Number of images to generate (1-10). Providers that only support single-image generation reject n > 1.
+        :param output_compression: Compression level (0-100) for webp/jpeg output. Ignored for png and by providers without a compression knob.
+        :param output_format: Encoding of the returned image bytes.
+        :param provider: Provider-specific passthrough configuration
+        :param quality: Rendering quality. Providers without a quality knob ignore this.
+        :param resolution: Normalized resolution tier of the generated image. Concrete pixel dimensions are derived per-provider.
+        :param seed: If specified, the generation will sample deterministically, such that repeated requests with the same seed and parameters should return the same result. Determinism is not guaranteed for all providers.
+        :param size: Optional. A convenience shorthand for output dimensions — pass a tier (\"2K\", \"4K\") or explicit pixels (\"2048x2048\") and we normalize it to the right dimensions for the chosen provider. Interchangeable with resolution + aspect_ratio; use those directly for enumerated, per-model discoverable values. Conflicting size + resolution/aspect_ratio is rejected.
+        :param stream: If true, partial images are streamed as SSE events as they become available. Only supported by providers with native streaming (currently OpenAI). Non-streaming providers ignore this flag and return a buffered response.
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param accept_header_override: Override the default accept header for this method
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.CreateImagesRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+            image_generation_request=components.ImageGenerationRequest(
+                aspect_ratio=aspect_ratio,
+                background=background,
+                input_references=utils.get_pydantic_model(
+                    input_references, Optional[List[components.ContentPartImage]]
+                ),
+                model=model,
+                n=n,
+                output_compression=output_compression,
+                output_format=output_format,
+                prompt=prompt,
+                provider=utils.get_pydantic_model(
+                    provider, Optional[components.ImageGenerationRequestProvider]
+                ),
+                quality=quality,
+                resolution=resolution,
+                seed=seed,
+                size=size,
+                stream=stream,
+            ),
+        )
+
+        req = self._build_request_async(
+            method="POST",
+            path="/images",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=True,
+            request_has_path_params=False,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="text/event-stream" if stream else "application/json",
+            http_headers=http_headers,
+            _globals=operations.CreateImagesGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            get_serialized_body=lambda: utils.serialize_request_body(
+                request.image_generation_request,
+                False,
+                False,
+                "json",
+                components.ImageGenerationRequest,
+            ),
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = await self.do_request_async(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="createImages",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=[
+                "400",
+                "401",
+                "402",
+                "403",
+                "404",
+                "429",
+                "4XX",
+                "500",
+                "502",
+                "524",
+                "529",
+                "5XX",
+            ],
+            stream=True,
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            return unmarshal_json_response(
+                components.ImageGenerationResponse, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "200", "text/event-stream"):
+            return eventstreaming.EventStreamAsync(
+                http_res,
+                lambda raw: utils.unmarshal_json(
+                    raw, components.ImageStreamingResponse
+                ).data,
+                sentinel="[DONE]",
+                client_ref=self,
+            )
+        if utils.match_response(http_res, "400", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.BadRequestResponseErrorData, http_res, http_res_text
+            )
+            raise errors.BadRequestResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "401", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.UnauthorizedResponseErrorData, http_res, http_res_text
+            )
+            raise errors.UnauthorizedResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "402", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.PaymentRequiredResponseErrorData, http_res, http_res_text
+            )
+            raise errors.PaymentRequiredResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "403", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.ForbiddenResponseErrorData, http_res, http_res_text
+            )
+            raise errors.ForbiddenResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "404", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.NotFoundResponseErrorData, http_res, http_res_text
+            )
+            raise errors.NotFoundResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "429", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.TooManyRequestsResponseErrorData, http_res, http_res_text
+            )
+            raise errors.TooManyRequestsResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "500", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res, http_res_text
+            )
+            raise errors.InternalServerResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "502", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.BadGatewayResponseErrorData, http_res, http_res_text
+            )
+            raise errors.BadGatewayResponseError(response_data, http_res, http_res_text)
+        if utils.match_response(http_res, "524", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.EdgeNetworkTimeoutResponseErrorData, http_res, http_res_text
+            )
+            raise errors.EdgeNetworkTimeoutResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "529", "application/json"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            response_data = unmarshal_json_response(
+                errors.ProviderOverloadedResponseErrorData, http_res, http_res_text
+            )
+            raise errors.ProviderOverloadedResponseError(
+                response_data, http_res, http_res_text
+            )
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        http_res_text = await utils.stream_to_text_async(http_res)
+        raise errors.OpenRouterDefaultError(
+            "Unexpected response received", http_res, http_res_text
+        )
+
+    def list_models(
+        self,
+        *,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.ImageModelsListResponse:
+        r"""List image generation models
+
+        Lists every image generation model with its top-level supported-parameter superset and a URL to its full per-endpoint records.
+
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.ListImageModelsRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+        )
+
+        req = self._build_request(
+            method="GET",
+            path="/images/models",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=False,
+            request_has_path_params=False,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="application/json",
+            http_headers=http_headers,
+            _globals=operations.ListImageModelsGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = self.do_request(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="listImageModels",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=["4XX", "500", "5XX"],
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            return unmarshal_json_response(components.ImageModelsListResponse, http_res)
+        if utils.match_response(http_res, "500", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res
+            )
+            raise errors.InternalServerResponseError(response_data, http_res)
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
+
+    async def list_models_async(
+        self,
+        *,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.ImageModelsListResponse:
+        r"""List image generation models
+
+        Lists every image generation model with its top-level supported-parameter superset and a URL to its full per-endpoint records.
+
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.ListImageModelsRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+        )
+
+        req = self._build_request_async(
+            method="GET",
+            path="/images/models",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=False,
+            request_has_path_params=False,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="application/json",
+            http_headers=http_headers,
+            _globals=operations.ListImageModelsGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = await self.do_request_async(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="listImageModels",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=["4XX", "500", "5XX"],
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            return unmarshal_json_response(components.ImageModelsListResponse, http_res)
+        if utils.match_response(http_res, "500", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res
+            )
+            raise errors.InternalServerResponseError(response_data, http_res)
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
+
+    def list_model_endpoints(
+        self,
+        *,
+        author: str,
+        slug: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.ImageModelEndpointsResponse:
+        r"""List endpoints for an image model
+
+        Returns the full per-endpoint records for an image model: each endpoint's definitive supported parameters, pricing, and passthrough allowlist.
+
+        :param author: Model author/organization
+        :param slug: Model slug
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.ListImageModelEndpointsRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+            author=author,
+            slug=slug,
+        )
+
+        req = self._build_request(
+            method="GET",
+            path="/images/models/{author}/{slug}/endpoints",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=False,
+            request_has_path_params=True,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="application/json",
+            http_headers=http_headers,
+            _globals=operations.ListImageModelEndpointsGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = self.do_request(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="listImageModelEndpoints",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=["404", "4XX", "500", "5XX"],
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            return unmarshal_json_response(
+                components.ImageModelEndpointsResponse, http_res
+            )
+        if utils.match_response(http_res, "404", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.NotFoundResponseErrorData, http_res
+            )
+            raise errors.NotFoundResponseError(response_data, http_res)
+        if utils.match_response(http_res, "500", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res
+            )
+            raise errors.InternalServerResponseError(response_data, http_res)
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = utils.stream_to_text(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
+
+    async def list_model_endpoints_async(
+        self,
+        *,
+        author: str,
+        slug: str,
+        http_referer: Optional[str] = None,
+        x_open_router_title: Optional[str] = None,
+        x_open_router_categories: Optional[str] = None,
+        retries: OptionalNullable[utils.RetryConfig] = UNSET,
+        server_url: Optional[str] = None,
+        timeout_ms: Optional[int] = None,
+        http_headers: Optional[Mapping[str, str]] = None,
+    ) -> components.ImageModelEndpointsResponse:
+        r"""List endpoints for an image model
+
+        Returns the full per-endpoint records for an image model: each endpoint's definitive supported parameters, pricing, and passthrough allowlist.
+
+        :param author: Model author/organization
+        :param slug: Model slug
+        :param http_referer: The app identifier should be your app's URL and is used as the primary identifier for rankings.
+            This is used to track API usage per application.
+
+        :param x_open_router_title: The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+        :param x_open_router_categories: Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+        :param retries: Override the default retry configuration for this method
+        :param server_url: Override the default server URL for this method
+        :param timeout_ms: Override the default request timeout configuration for this method in milliseconds
+        :param http_headers: Additional headers to set or replace on requests.
+        """
+        base_url = None
+        url_variables = None
+        if timeout_ms is None:
+            timeout_ms = self.sdk_configuration.timeout_ms
+
+        if server_url is not None:
+            base_url = server_url
+        else:
+            base_url = self._get_url(base_url, url_variables)
+
+        request = operations.ListImageModelEndpointsRequest(
+            http_referer=http_referer,
+            x_open_router_title=x_open_router_title,
+            x_open_router_categories=x_open_router_categories,
+            author=author,
+            slug=slug,
+        )
+
+        req = self._build_request_async(
+            method="GET",
+            path="/images/models/{author}/{slug}/endpoints",
+            base_url=base_url,
+            url_variables=url_variables,
+            request=request,
+            request_body_required=False,
+            request_has_path_params=True,
+            request_has_query_params=True,
+            user_agent_header="user-agent",
+            accept_header_value="application/json",
+            http_headers=http_headers,
+            _globals=operations.ListImageModelEndpointsGlobals(
+                http_referer=self.sdk_configuration.globals.http_referer,
+                x_open_router_title=self.sdk_configuration.globals.x_open_router_title,
+                x_open_router_categories=self.sdk_configuration.globals.x_open_router_categories,
+            ),
+            security=self.sdk_configuration.security,
+            allow_empty_value=None,
+            timeout_ms=timeout_ms,
+        )
+
+        if retries == UNSET:
+            if self.sdk_configuration.retry_config is not UNSET:
+                retries = self.sdk_configuration.retry_config
+            else:
+                retries = utils.RetryConfig(
+                    "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True
+                )
+
+        retry_config = None
+        if isinstance(retries, utils.RetryConfig):
+            retry_config = (retries, ["5XX"])
+
+        http_res = await self.do_request_async(
+            hook_ctx=HookContext(
+                config=self.sdk_configuration,
+                base_url=base_url or "",
+                operation_id="listImageModelEndpoints",
+                oauth2_scopes=None,
+                security_source=get_security_from_env(
+                    self.sdk_configuration.security, components.Security
+                ),
+            ),
+            request=req,
+            error_status_codes=["404", "4XX", "500", "5XX"],
+            retry_config=retry_config,
+        )
+
+        response_data: Any = None
+        if utils.match_response(http_res, "200", "application/json"):
+            return unmarshal_json_response(
+                components.ImageModelEndpointsResponse, http_res
+            )
+        if utils.match_response(http_res, "404", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.NotFoundResponseErrorData, http_res
+            )
+            raise errors.NotFoundResponseError(response_data, http_res)
+        if utils.match_response(http_res, "500", "application/json"):
+            response_data = unmarshal_json_response(
+                errors.InternalServerResponseErrorData, http_res
+            )
+            raise errors.InternalServerResponseError(response_data, http_res)
+        if utils.match_response(http_res, "4XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+        if utils.match_response(http_res, "5XX", "*"):
+            http_res_text = await utils.stream_to_text_async(http_res)
+            raise errors.OpenRouterDefaultError(
+                "API error occurred", http_res, http_res_text
+            )
+
+        raise errors.OpenRouterDefaultError("Unexpected response received", http_res)
diff --git a/src/openrouter/operations/__init__.py b/src/openrouter/operations/__init__.py
index 8b12f089..1159429a 100644
--- a/src/openrouter/operations/__init__.py
+++ b/src/openrouter/operations/__init__.py
@@ -81,6 +81,8 @@
         ContentText,
         ContentTextTypedDict,
         ContentTypedDict,
+        CostDetails,
+        CostDetailsTypedDict,
         CreateEmbeddingsData,
         CreateEmbeddingsDataTypedDict,
         CreateEmbeddingsGlobals,
@@ -117,6 +119,14 @@
         CreateGuardrailRequest,
         CreateGuardrailRequestTypedDict,
     )
+    from .createimages import (
+        CreateImagesGlobals,
+        CreateImagesGlobalsTypedDict,
+        CreateImagesRequest,
+        CreateImagesRequestTypedDict,
+        CreateImagesResponse,
+        CreateImagesResponseTypedDict,
+    )
     from .createkeys import (
         CreateKeysData,
         CreateKeysDataTypedDict,
@@ -290,18 +300,14 @@
         GetAppRankingsSort,
         Subcategory,
     )
-    from .getbenchmarksartificialanalysis import (
-        GetBenchmarksArtificialAnalysisGlobals,
-        GetBenchmarksArtificialAnalysisGlobalsTypedDict,
-        GetBenchmarksArtificialAnalysisRequest,
-        GetBenchmarksArtificialAnalysisRequestTypedDict,
-    )
-    from .getbenchmarksdesignarena import (
+    from .getbenchmarks import (
         Arena,
-        GetBenchmarksDesignArenaGlobals,
-        GetBenchmarksDesignArenaGlobalsTypedDict,
-        GetBenchmarksDesignArenaRequest,
-        GetBenchmarksDesignArenaRequestTypedDict,
+        GetBenchmarksGlobals,
+        GetBenchmarksGlobalsTypedDict,
+        GetBenchmarksRequest,
+        GetBenchmarksRequestTypedDict,
+        Source,
+        TaskType,
     )
     from .getbyokkey import (
         GetBYOKKeyGlobals,
@@ -497,6 +503,18 @@
         ListGuardrailsResponse,
         ListGuardrailsResponseTypedDict,
     )
+    from .listimagemodelendpoints import (
+        ListImageModelEndpointsGlobals,
+        ListImageModelEndpointsGlobalsTypedDict,
+        ListImageModelEndpointsRequest,
+        ListImageModelEndpointsRequestTypedDict,
+    )
+    from .listimagemodels import (
+        ListImageModelsGlobals,
+        ListImageModelsGlobalsTypedDict,
+        ListImageModelsRequest,
+        ListImageModelsRequestTypedDict,
+    )
     from .listkeyassignments import (
         ListKeyAssignmentsGlobals,
         ListKeyAssignmentsGlobalsTypedDict,
@@ -723,6 +741,8 @@
     "ContentText",
     "ContentTextTypedDict",
     "ContentTypedDict",
+    "CostDetails",
+    "CostDetailsTypedDict",
     "CreateAudioSpeechGlobals",
     "CreateAudioSpeechGlobalsTypedDict",
     "CreateAudioSpeechRequest",
@@ -764,6 +784,12 @@
     "CreateGuardrailGlobalsTypedDict",
     "CreateGuardrailRequest",
     "CreateGuardrailRequestTypedDict",
+    "CreateImagesGlobals",
+    "CreateImagesGlobalsTypedDict",
+    "CreateImagesRequest",
+    "CreateImagesRequestTypedDict",
+    "CreateImagesResponse",
+    "CreateImagesResponseTypedDict",
     "CreateKeysData",
     "CreateKeysDataTypedDict",
     "CreateKeysGlobals",
@@ -899,14 +925,10 @@
     "GetBYOKKeyGlobalsTypedDict",
     "GetBYOKKeyRequest",
     "GetBYOKKeyRequestTypedDict",
-    "GetBenchmarksArtificialAnalysisGlobals",
-    "GetBenchmarksArtificialAnalysisGlobalsTypedDict",
-    "GetBenchmarksArtificialAnalysisRequest",
-    "GetBenchmarksArtificialAnalysisRequestTypedDict",
-    "GetBenchmarksDesignArenaGlobals",
-    "GetBenchmarksDesignArenaGlobalsTypedDict",
-    "GetBenchmarksDesignArenaRequest",
-    "GetBenchmarksDesignArenaRequestTypedDict",
+    "GetBenchmarksGlobals",
+    "GetBenchmarksGlobalsTypedDict",
+    "GetBenchmarksRequest",
+    "GetBenchmarksRequestTypedDict",
     "GetCreditsData",
     "GetCreditsDataTypedDict",
     "GetCreditsGlobals",
@@ -1045,6 +1067,14 @@
     "ListGuardrailsRequestTypedDict",
     "ListGuardrailsResponse",
     "ListGuardrailsResponseTypedDict",
+    "ListImageModelEndpointsGlobals",
+    "ListImageModelEndpointsGlobalsTypedDict",
+    "ListImageModelEndpointsRequest",
+    "ListImageModelEndpointsRequestTypedDict",
+    "ListImageModelsGlobals",
+    "ListImageModelsGlobalsTypedDict",
+    "ListImageModelsRequest",
+    "ListImageModelsRequestTypedDict",
     "ListKeyAssignmentsGlobals",
     "ListKeyAssignmentsGlobalsTypedDict",
     "ListKeyAssignmentsRequest",
@@ -1163,7 +1193,9 @@
     "SendChatCompletionRequestRequestTypedDict",
     "SendChatCompletionRequestResponse",
     "SendChatCompletionRequestResponseTypedDict",
+    "Source",
     "Subcategory",
+    "TaskType",
     "TimeRange",
     "TimeRangeTypedDict",
     "TypeImageURL",
@@ -1269,6 +1301,8 @@
     "ContentText": ".createembeddings",
     "ContentTextTypedDict": ".createembeddings",
     "ContentTypedDict": ".createembeddings",
+    "CostDetails": ".createembeddings",
+    "CostDetailsTypedDict": ".createembeddings",
     "CreateEmbeddingsData": ".createembeddings",
     "CreateEmbeddingsDataTypedDict": ".createembeddings",
     "CreateEmbeddingsGlobals": ".createembeddings",
@@ -1302,6 +1336,12 @@
     "CreateGuardrailGlobalsTypedDict": ".createguardrail",
     "CreateGuardrailRequest": ".createguardrail",
     "CreateGuardrailRequestTypedDict": ".createguardrail",
+    "CreateImagesGlobals": ".createimages",
+    "CreateImagesGlobalsTypedDict": ".createimages",
+    "CreateImagesRequest": ".createimages",
+    "CreateImagesRequestTypedDict": ".createimages",
+    "CreateImagesResponse": ".createimages",
+    "CreateImagesResponseTypedDict": ".createimages",
     "CreateKeysData": ".createkeys",
     "CreateKeysDataTypedDict": ".createkeys",
     "CreateKeysGlobals": ".createkeys",
@@ -1435,15 +1475,13 @@
     "GetAppRankingsResponseTypedDict": ".getapprankings",
     "GetAppRankingsSort": ".getapprankings",
     "Subcategory": ".getapprankings",
-    "GetBenchmarksArtificialAnalysisGlobals": ".getbenchmarksartificialanalysis",
-    "GetBenchmarksArtificialAnalysisGlobalsTypedDict": ".getbenchmarksartificialanalysis",
-    "GetBenchmarksArtificialAnalysisRequest": ".getbenchmarksartificialanalysis",
-    "GetBenchmarksArtificialAnalysisRequestTypedDict": ".getbenchmarksartificialanalysis",
-    "Arena": ".getbenchmarksdesignarena",
-    "GetBenchmarksDesignArenaGlobals": ".getbenchmarksdesignarena",
-    "GetBenchmarksDesignArenaGlobalsTypedDict": ".getbenchmarksdesignarena",
-    "GetBenchmarksDesignArenaRequest": ".getbenchmarksdesignarena",
-    "GetBenchmarksDesignArenaRequestTypedDict": ".getbenchmarksdesignarena",
+    "Arena": ".getbenchmarks",
+    "GetBenchmarksGlobals": ".getbenchmarks",
+    "GetBenchmarksGlobalsTypedDict": ".getbenchmarks",
+    "GetBenchmarksRequest": ".getbenchmarks",
+    "GetBenchmarksRequestTypedDict": ".getbenchmarks",
+    "Source": ".getbenchmarks",
+    "TaskType": ".getbenchmarks",
     "GetBYOKKeyGlobals": ".getbyokkey",
     "GetBYOKKeyGlobalsTypedDict": ".getbyokkey",
     "GetBYOKKeyRequest": ".getbyokkey",
@@ -1586,6 +1624,14 @@
     "ListGuardrailsRequestTypedDict": ".listguardrails",
     "ListGuardrailsResponse": ".listguardrails",
     "ListGuardrailsResponseTypedDict": ".listguardrails",
+    "ListImageModelEndpointsGlobals": ".listimagemodelendpoints",
+    "ListImageModelEndpointsGlobalsTypedDict": ".listimagemodelendpoints",
+    "ListImageModelEndpointsRequest": ".listimagemodelendpoints",
+    "ListImageModelEndpointsRequestTypedDict": ".listimagemodelendpoints",
+    "ListImageModelsGlobals": ".listimagemodels",
+    "ListImageModelsGlobalsTypedDict": ".listimagemodels",
+    "ListImageModelsRequest": ".listimagemodels",
+    "ListImageModelsRequestTypedDict": ".listimagemodels",
     "ListKeyAssignmentsGlobals": ".listkeyassignments",
     "ListKeyAssignmentsGlobalsTypedDict": ".listkeyassignments",
     "ListKeyAssignmentsRequest": ".listkeyassignments",
diff --git a/src/openrouter/operations/createembeddings.py b/src/openrouter/operations/createembeddings.py
index 4cc4c5c0..6459cab7 100644
--- a/src/openrouter/operations/createembeddings.py
+++ b/src/openrouter/operations/createembeddings.py
@@ -344,6 +344,54 @@ class CreateEmbeddingsData(BaseModel):
 Object = Literal["list",]
 
 
+class CostDetailsTypedDict(TypedDict):
+    r"""Breakdown of upstream inference costs"""
+
+    upstream_inference_completions_cost: float
+    upstream_inference_prompt_cost: float
+    upstream_inference_cost: NotRequired[Nullable[float]]
+
+
+class CostDetails(BaseModel):
+    r"""Breakdown of upstream inference costs"""
+
+    upstream_inference_completions_cost: float
+
+    upstream_inference_prompt_cost: float
+
+    upstream_inference_cost: OptionalNullable[float] = UNSET
+
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = ["upstream_inference_cost"]
+        nullable_fields = ["upstream_inference_cost"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
+
 class PromptTokensDetailsTypedDict(TypedDict):
     r"""Per-modality token breakdown. Only present when the input contains 2+ modalities (e.g. text + image) and the upstream provider returns modality-level usage data. Only non-zero modality counts are included."""
 
@@ -387,6 +435,10 @@ class CreateEmbeddingsUsageTypedDict(TypedDict):
     r"""Total number of tokens used"""
     cost: NotRequired[float]
     r"""Cost of the request in credits"""
+    cost_details: NotRequired[Nullable[CostDetailsTypedDict]]
+    r"""Breakdown of upstream inference costs"""
+    is_byok: NotRequired[bool]
+    r"""Whether a request was made using a Bring Your Own Key configuration"""
     prompt_tokens_details: NotRequired[PromptTokensDetailsTypedDict]
     r"""Per-modality token breakdown. Only present when the input contains 2+ modalities (e.g. text + image) and the upstream provider returns modality-level usage data. Only non-zero modality counts are included."""
 
@@ -403,9 +455,45 @@ class CreateEmbeddingsUsage(BaseModel):
     cost: Optional[float] = None
     r"""Cost of the request in credits"""
 
+    cost_details: OptionalNullable[CostDetails] = UNSET
+    r"""Breakdown of upstream inference costs"""
+
+    is_byok: Optional[bool] = None
+    r"""Whether a request was made using a Bring Your Own Key configuration"""
+
     prompt_tokens_details: Optional[PromptTokensDetails] = None
     r"""Per-modality token breakdown. Only present when the input contains 2+ modalities (e.g. text + image) and the upstream provider returns modality-level usage data. Only non-zero modality counts are included."""
 
+    @model_serializer(mode="wrap")
+    def serialize_model(self, handler):
+        optional_fields = ["cost", "cost_details", "is_byok", "prompt_tokens_details"]
+        nullable_fields = ["cost_details"]
+        null_default_fields = []
+
+        serialized = handler(self)
+
+        m = {}
+
+        for n, f in type(self).model_fields.items():
+            k = f.alias or n
+            val = serialized.get(k)
+            serialized.pop(k, None)
+
+            optional_nullable = k in optional_fields and k in nullable_fields
+            is_set = (
+                self.__pydantic_fields_set__.intersection({n})
+                or k in null_default_fields
+            )  # pylint: disable=no-member
+
+            if val is not None and val != UNSET_SENTINEL:
+                m[k] = val
+            elif val != UNSET_SENTINEL and (
+                not k in optional_fields or (optional_nullable and is_set)
+            ):
+                m[k] = val
+
+        return m
+
 
 class CreateEmbeddingsResponseBodyTypedDict(TypedDict):
     r"""Embeddings response containing embedding vectors"""
diff --git a/src/openrouter/operations/getbenchmarksdesignarena.py b/src/openrouter/operations/createimages.py
similarity index 63%
rename from src/openrouter/operations/getbenchmarksdesignarena.py
rename to src/openrouter/operations/createimages.py
index 2ac2aed2..dcc89c26 100644
--- a/src/openrouter/operations/getbenchmarksdesignarena.py
+++ b/src/openrouter/operations/createimages.py
@@ -1,20 +1,24 @@
 """Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
 
 from __future__ import annotations
-from openrouter.types import BaseModel, UnrecognizedStr
+from openrouter.components import (
+    imagegenerationrequest as components_imagegenerationrequest,
+    imagegenerationresponse as components_imagegenerationresponse,
+    imagestreamingresponse as components_imagestreamingresponse,
+)
+from openrouter.types import BaseModel
 from openrouter.utils import (
     FieldMetadata,
     HeaderMetadata,
-    QueryParamMetadata,
-    validate_open_enum,
+    RequestMetadata,
+    eventstreaming,
 )
 import pydantic
-from pydantic.functional_validators import PlainValidator
-from typing import Literal, Optional, Union
-from typing_extensions import Annotated, NotRequired, TypedDict
+from typing import Optional, Union
+from typing_extensions import Annotated, NotRequired, TypeAliasType, TypedDict
 
 
-class GetBenchmarksDesignArenaGlobalsTypedDict(TypedDict):
+class CreateImagesGlobalsTypedDict(TypedDict):
     http_referer: NotRequired[str]
     r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
     This is used to track API usage per application.
@@ -30,7 +34,7 @@ class GetBenchmarksDesignArenaGlobalsTypedDict(TypedDict):
     """
 
 
-class GetBenchmarksDesignArenaGlobals(BaseModel):
+class CreateImagesGlobals(BaseModel):
     http_referer: Annotated[
         Optional[str],
         pydantic.Field(alias="HTTP-Referer"),
@@ -60,18 +64,10 @@ class GetBenchmarksDesignArenaGlobals(BaseModel):
     """
 
 
-Arena = Union[
-    Literal[
-        "models",
-        "builders",
-        "agents",
-    ],
-    UnrecognizedStr,
-]
-r"""Arena to query. Defaults to `models`."""
-
-
-class GetBenchmarksDesignArenaRequestTypedDict(TypedDict):
+class CreateImagesRequestTypedDict(TypedDict):
+    image_generation_request: (
+        components_imagegenerationrequest.ImageGenerationRequestTypedDict
+    )
     http_referer: NotRequired[str]
     r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
     This is used to track API usage per application.
@@ -85,15 +81,14 @@ class GetBenchmarksDesignArenaRequestTypedDict(TypedDict):
     r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
 
     """
-    arena: NotRequired[Arena]
-    r"""Arena to query. Defaults to `models`."""
-    category: NotRequired[str]
-    r"""Category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories."""
-    max_results: NotRequired[int]
-    r"""Max results to return: per category when no category filter is applied (1–100, default 50)."""
 
 
-class GetBenchmarksDesignArenaRequest(BaseModel):
+class CreateImagesRequest(BaseModel):
+    image_generation_request: Annotated[
+        components_imagegenerationrequest.ImageGenerationRequest,
+        FieldMetadata(request=RequestMetadata(media_type="application/json")),
+    ]
+
     http_referer: Annotated[
         Optional[str],
         pydantic.Field(alias="HTTP-Referer"),
@@ -122,20 +117,34 @@ class GetBenchmarksDesignArenaRequest(BaseModel):
 
     """
 
-    arena: Annotated[
-        Annotated[Optional[Arena], PlainValidator(validate_open_enum(False))],
-        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
-    ] = "models"
-    r"""Arena to query. Defaults to `models`."""
 
-    category: Annotated[
-        Optional[str],
-        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
-    ] = None
-    r"""Category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories."""
+CreateImagesResponseTypedDict = TypeAliasType(
+    "CreateImagesResponseTypedDict",
+    Union[
+        components_imagegenerationresponse.ImageGenerationResponseTypedDict,
+        Union[
+            eventstreaming.EventStream[
+                components_imagestreamingresponse.ImageStreamingResponseDataTypedDict
+            ],
+            eventstreaming.EventStreamAsync[
+                components_imagestreamingresponse.ImageStreamingResponseDataTypedDict
+            ],
+        ],
+    ],
+)
 
-    max_results: Annotated[
-        Optional[int],
-        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
-    ] = 50
-    r"""Max results to return: per category when no category filter is applied (1–100, default 50)."""
+
+CreateImagesResponse = TypeAliasType(
+    "CreateImagesResponse",
+    Union[
+        components_imagegenerationresponse.ImageGenerationResponse,
+        Union[
+            eventstreaming.EventStream[
+                components_imagestreamingresponse.ImageStreamingResponseData
+            ],
+            eventstreaming.EventStreamAsync[
+                components_imagestreamingresponse.ImageStreamingResponseData
+            ],
+        ],
+    ],
+)
diff --git a/src/openrouter/operations/getbenchmarks.py b/src/openrouter/operations/getbenchmarks.py
new file mode 100644
index 00000000..480c2f31
--- /dev/null
+++ b/src/openrouter/operations/getbenchmarks.py
@@ -0,0 +1,178 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel, UnrecognizedStr
+from openrouter.utils import (
+    FieldMetadata,
+    HeaderMetadata,
+    QueryParamMetadata,
+    validate_open_enum,
+)
+import pydantic
+from pydantic.functional_validators import PlainValidator
+from typing import Literal, Optional, Union
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+class GetBenchmarksGlobalsTypedDict(TypedDict):
+    http_referer: NotRequired[str]
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+    x_open_router_title: NotRequired[str]
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+    x_open_router_categories: NotRequired[str]
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+
+
+class GetBenchmarksGlobals(BaseModel):
+    http_referer: Annotated[
+        Optional[str],
+        pydantic.Field(alias="HTTP-Referer"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+
+    x_open_router_title: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Title"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+
+    x_open_router_categories: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Categories"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+
+
+Source = Union[
+    Literal[
+        "artificial-analysis",
+        "design-arena",
+    ],
+    UnrecognizedStr,
+]
+r"""Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources."""
+
+
+TaskType = Union[
+    Literal[
+        "coding",
+        "intelligence",
+        "agentic",
+    ],
+    UnrecognizedStr,
+]
+r"""Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category."""
+
+
+Arena = Union[
+    Literal[
+        "models",
+        "builders",
+        "agents",
+    ],
+    UnrecognizedStr,
+]
+r"""Design Arena only: arena to query. Defaults to `models` when source is `design-arena`."""
+
+
+class GetBenchmarksRequestTypedDict(TypedDict):
+    http_referer: NotRequired[str]
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+    x_open_router_title: NotRequired[str]
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+    x_open_router_categories: NotRequired[str]
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+    source: NotRequired[Source]
+    r"""Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources."""
+    task_type: NotRequired[TaskType]
+    r"""Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category."""
+    arena: NotRequired[Arena]
+    r"""Design Arena only: arena to query. Defaults to `models` when source is `design-arena`."""
+    category: NotRequired[str]
+    r"""Design Arena only: category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories."""
+    max_results: NotRequired[int]
+    r"""Maximum number of items to return. When omitted, all matching results are returned."""
+
+
+class GetBenchmarksRequest(BaseModel):
+    http_referer: Annotated[
+        Optional[str],
+        pydantic.Field(alias="HTTP-Referer"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+
+    x_open_router_title: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Title"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+
+    x_open_router_categories: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Categories"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+
+    source: Annotated[
+        Annotated[Optional[Source], PlainValidator(validate_open_enum(False))],
+        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
+    ] = None
+    r"""Benchmark source to query. Determines the shape of the returned items. When omitted, returns results from all sources."""
+
+    task_type: Annotated[
+        Annotated[Optional[TaskType], PlainValidator(validate_open_enum(False))],
+        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
+    ] = None
+    r"""Filter results by task type. For Artificial Analysis, maps to the corresponding index. For Design Arena, maps to the matching category."""
+
+    arena: Annotated[
+        Annotated[Optional[Arena], PlainValidator(validate_open_enum(False))],
+        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
+    ] = None
+    r"""Design Arena only: arena to query. Defaults to `models` when source is `design-arena`."""
+
+    category: Annotated[
+        Optional[str],
+        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
+    ] = None
+    r"""Design Arena only: category within the arena (e.g. `codecategories`, `uicomponent`, `gamedev`, `3d`, `dataviz`, `image`, `video`, `svg`). When omitted, returns all categories."""
+
+    max_results: Annotated[
+        Optional[int],
+        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
+    ] = None
+    r"""Maximum number of items to return. When omitted, all matching results are returned."""
diff --git a/src/openrouter/operations/listimagemodelendpoints.py b/src/openrouter/operations/listimagemodelendpoints.py
new file mode 100644
index 00000000..15c606cc
--- /dev/null
+++ b/src/openrouter/operations/listimagemodelendpoints.py
@@ -0,0 +1,114 @@
+"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT."""
+
+from __future__ import annotations
+from openrouter.types import BaseModel
+from openrouter.utils import FieldMetadata, HeaderMetadata, PathParamMetadata
+import pydantic
+from typing import Optional
+from typing_extensions import Annotated, NotRequired, TypedDict
+
+
+class ListImageModelEndpointsGlobalsTypedDict(TypedDict):
+    http_referer: NotRequired[str]
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+    x_open_router_title: NotRequired[str]
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+    x_open_router_categories: NotRequired[str]
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+
+
+class ListImageModelEndpointsGlobals(BaseModel):
+    http_referer: Annotated[
+        Optional[str],
+        pydantic.Field(alias="HTTP-Referer"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+
+    x_open_router_title: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Title"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+
+    x_open_router_categories: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Categories"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+
+
+class ListImageModelEndpointsRequestTypedDict(TypedDict):
+    author: str
+    r"""Model author/organization"""
+    slug: str
+    r"""Model slug"""
+    http_referer: NotRequired[str]
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+    x_open_router_title: NotRequired[str]
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+    x_open_router_categories: NotRequired[str]
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
+
+
+class ListImageModelEndpointsRequest(BaseModel):
+    author: Annotated[
+        str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False))
+    ]
+    r"""Model author/organization"""
+
+    slug: Annotated[
+        str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False))
+    ]
+    r"""Model slug"""
+
+    http_referer: Annotated[
+        Optional[str],
+        pydantic.Field(alias="HTTP-Referer"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
+    This is used to track API usage per application.
+
+    """
+
+    x_open_router_title: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Title"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""The app display name allows you to customize how your app appears in OpenRouter's dashboard.
+
+    """
+
+    x_open_router_categories: Annotated[
+        Optional[str],
+        pydantic.Field(alias="X-OpenRouter-Categories"),
+        FieldMetadata(header=HeaderMetadata(style="simple", explode=False)),
+    ] = None
+    r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
+
+    """
diff --git a/src/openrouter/operations/getbenchmarksartificialanalysis.py b/src/openrouter/operations/listimagemodels.py
similarity index 84%
rename from src/openrouter/operations/getbenchmarksartificialanalysis.py
rename to src/openrouter/operations/listimagemodels.py
index 707ed912..e5c89ce7 100644
--- a/src/openrouter/operations/getbenchmarksartificialanalysis.py
+++ b/src/openrouter/operations/listimagemodels.py
@@ -2,13 +2,13 @@
 
 from __future__ import annotations
 from openrouter.types import BaseModel
-from openrouter.utils import FieldMetadata, HeaderMetadata, QueryParamMetadata
+from openrouter.utils import FieldMetadata, HeaderMetadata
 import pydantic
 from typing import Optional
 from typing_extensions import Annotated, NotRequired, TypedDict
 
 
-class GetBenchmarksArtificialAnalysisGlobalsTypedDict(TypedDict):
+class ListImageModelsGlobalsTypedDict(TypedDict):
     http_referer: NotRequired[str]
     r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
     This is used to track API usage per application.
@@ -24,7 +24,7 @@ class GetBenchmarksArtificialAnalysisGlobalsTypedDict(TypedDict):
     """
 
 
-class GetBenchmarksArtificialAnalysisGlobals(BaseModel):
+class ListImageModelsGlobals(BaseModel):
     http_referer: Annotated[
         Optional[str],
         pydantic.Field(alias="HTTP-Referer"),
@@ -54,7 +54,7 @@ class GetBenchmarksArtificialAnalysisGlobals(BaseModel):
     """
 
 
-class GetBenchmarksArtificialAnalysisRequestTypedDict(TypedDict):
+class ListImageModelsRequestTypedDict(TypedDict):
     http_referer: NotRequired[str]
     r"""The app identifier should be your app's URL and is used as the primary identifier for rankings.
     This is used to track API usage per application.
@@ -68,11 +68,9 @@ class GetBenchmarksArtificialAnalysisRequestTypedDict(TypedDict):
     r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
 
     """
-    max_results: NotRequired[int]
-    r"""Max results to return (1–100, default 50)."""
 
 
-class GetBenchmarksArtificialAnalysisRequest(BaseModel):
+class ListImageModelsRequest(BaseModel):
     http_referer: Annotated[
         Optional[str],
         pydantic.Field(alias="HTTP-Referer"),
@@ -100,9 +98,3 @@ class GetBenchmarksArtificialAnalysisRequest(BaseModel):
     r"""Comma-separated list of app categories (e.g. \"cli-agent,cloud-agent\"). Used for marketplace rankings.
 
     """
-
-    max_results: Annotated[
-        Optional[int],
-        FieldMetadata(query=QueryParamMetadata(style="form", explode=True)),
-    ] = 50
-    r"""Max results to return (1–100, default 50)."""
diff --git a/src/openrouter/presets.py b/src/openrouter/presets.py
index ae12a80d..0272fbee 100644
--- a/src/openrouter/presets.py
+++ b/src/openrouter/presets.py
@@ -1886,6 +1886,9 @@ def create_presets_responses(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -1981,6 +1984,7 @@ def create_presets_responses(
 
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -2040,6 +2044,9 @@ def create_presets_responses(
                 cache_control=utils.get_pydantic_model(
                     cache_control, Optional[components.AnthropicCacheControlDirective]
                 ),
+                debug=utils.get_pydantic_model(
+                    debug, Optional[components.ChatDebugOptions]
+                ),
                 frequency_penalty=frequency_penalty,
                 image_config=image_config,
                 include=include,
@@ -2212,6 +2219,9 @@ async def create_presets_responses_async(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -2307,6 +2317,7 @@ async def create_presets_responses_async(
 
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -2366,6 +2377,9 @@ async def create_presets_responses_async(
                 cache_control=utils.get_pydantic_model(
                     cache_control, Optional[components.AnthropicCacheControlDirective]
                 ),
+                debug=utils.get_pydantic_model(
+                    debug, Optional[components.ChatDebugOptions]
+                ),
                 frequency_penalty=frequency_penalty,
                 image_config=image_config,
                 include=include,
diff --git a/src/openrouter/responses.py b/src/openrouter/responses.py
index 944aff9a..e80404c4 100644
--- a/src/openrouter/responses.py
+++ b/src/openrouter/responses.py
@@ -33,6 +33,9 @@ def send(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -128,6 +131,7 @@ def send(
         :param x_open_router_metadata: Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -184,6 +188,9 @@ def send(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -279,6 +286,7 @@ def send(
         :param x_open_router_metadata: Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -334,6 +342,9 @@ def send(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -429,6 +440,7 @@ def send(
         :param x_open_router_metadata: Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -489,6 +501,9 @@ def send(
                 cache_control=utils.get_pydantic_model(
                     cache_control, Optional[components.AnthropicCacheControlDirective]
                 ),
+                debug=utils.get_pydantic_model(
+                    debug, Optional[components.ChatDebugOptions]
+                ),
                 frequency_penalty=frequency_penalty,
                 image_config=image_config,
                 include=include,
@@ -767,6 +782,9 @@ async def send_async(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -862,6 +880,7 @@ async def send_async(
         :param x_open_router_metadata: Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -918,6 +937,9 @@ async def send_async(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -1013,6 +1035,7 @@ async def send_async(
         :param x_open_router_metadata: Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -1068,6 +1091,9 @@ async def send_async(
                 components.AnthropicCacheControlDirectiveTypedDict,
             ]
         ] = None,
+        debug: Optional[
+            Union[components.ChatDebugOptions, components.ChatDebugOptionsTypedDict]
+        ] = None,
         frequency_penalty: OptionalNullable[float] = UNSET,
         image_config: Optional[
             Union[
@@ -1163,6 +1189,7 @@ async def send_async(
         :param x_open_router_metadata: Opt-in to surface routing metadata on the response under `openrouter_metadata`. Defaults to `disabled`. The legacy header `X-OpenRouter-Experimental-Metadata` is also accepted for backward compatibility.
         :param background:
         :param cache_control: Enable automatic prompt caching. When set at the top level, the system automatically applies cache breakpoints to the last cacheable block in the request. Currently supported for Anthropic Claude models.
+        :param debug: Debug options for inspecting request transformations (streaming only)
         :param frequency_penalty:
         :param image_config: Provider-specific image configuration options. Keys and values vary by model/provider. See https://openrouter.ai/docs/guides/overview/multimodal/image-generation for more details.
         :param include:
@@ -1223,6 +1250,9 @@ async def send_async(
                 cache_control=utils.get_pydantic_model(
                     cache_control, Optional[components.AnthropicCacheControlDirective]
                 ),
+                debug=utils.get_pydantic_model(
+                    debug, Optional[components.ChatDebugOptions]
+                ),
                 frequency_penalty=frequency_penalty,
                 image_config=image_config,
                 include=include,
diff --git a/src/openrouter/sdk.py b/src/openrouter/sdk.py
index abc46c83..729932c8 100644
--- a/src/openrouter/sdk.py
+++ b/src/openrouter/sdk.py
@@ -18,6 +18,7 @@
 if TYPE_CHECKING:
     from openrouter.analytics import Analytics
     from openrouter.api_keys import APIKeys
+    from openrouter.benchmarks import Benchmarks
     from openrouter.beta import Beta
     from openrouter.byok import Byok
     from openrouter.chat import Chat
@@ -28,6 +29,7 @@
     from openrouter.files import Files
     from openrouter.generations import Generations
     from openrouter.guardrails import Guardrails
+    from openrouter.images import Images
     from openrouter.models_ import Models
     from openrouter.oauth import OAuth
     from openrouter.observability import Observability
@@ -55,6 +57,8 @@ class OpenRouter(BaseSDK):
     r"""Speech-to-text endpoints"""
     o_auth: "OAuth"
     r"""OAuth authentication endpoints"""
+    benchmarks: "Benchmarks"
+    r"""Benchmarks endpoints"""
     byok: "Byok"
     r"""BYOK endpoints"""
     chat: "Chat"
@@ -72,6 +76,8 @@ class OpenRouter(BaseSDK):
     r"""Generation history endpoints"""
     guardrails: "Guardrails"
     r"""Guardrails endpoints"""
+    images: "Images"
+    r"""Images endpoints"""
     api_keys: "APIKeys"
     r"""API key management endpoints"""
     models: "Models"
@@ -96,6 +102,7 @@ class OpenRouter(BaseSDK):
         "tts": ("openrouter.tts", "Tts"),
         "stt": ("openrouter.stt", "Stt"),
         "o_auth": ("openrouter.oauth", "OAuth"),
+        "benchmarks": ("openrouter.benchmarks", "Benchmarks"),
         "byok": ("openrouter.byok", "Byok"),
         "chat": ("openrouter.chat", "Chat"),
         "credits": ("openrouter.credits", "Credits"),
@@ -105,6 +112,7 @@ class OpenRouter(BaseSDK):
         "files": ("openrouter.files", "Files"),
         "generations": ("openrouter.generations", "Generations"),
         "guardrails": ("openrouter.guardrails", "Guardrails"),
+        "images": ("openrouter.images", "Images"),
         "api_keys": ("openrouter.api_keys", "APIKeys"),
         "models": ("openrouter.models_", "Models"),
         "observability": ("openrouter.observability", "Observability"),
diff --git a/src/openrouter/video_generation.py b/src/openrouter/video_generation.py
index 30f265d1..cdd7182f 100644
--- a/src/openrouter/video_generation.py
+++ b/src/openrouter/video_generation.py
@@ -21,7 +21,7 @@ def generate(
         http_referer: Optional[str] = None,
         x_open_router_title: Optional[str] = None,
         x_open_router_categories: Optional[str] = None,
-        aspect_ratio: Optional[components.AspectRatio] = None,
+        aspect_ratio: Optional[components.VideoGenerationRequestAspectRatio] = None,
         callback_url: Optional[str] = None,
         duration: Optional[int] = None,
         frame_images: Optional[
@@ -40,7 +40,7 @@ def generate(
                 components.VideoGenerationRequestProviderTypedDict,
             ]
         ] = None,
-        resolution: Optional[components.Resolution] = None,
+        resolution: Optional[components.VideoGenerationRequestResolution] = None,
         seed: Optional[int] = None,
         size: Optional[str] = None,
         retries: OptionalNullable[utils.RetryConfig] = UNSET,
@@ -222,7 +222,7 @@ async def generate_async(
         http_referer: Optional[str] = None,
         x_open_router_title: Optional[str] = None,
         x_open_router_categories: Optional[str] = None,
-        aspect_ratio: Optional[components.AspectRatio] = None,
+        aspect_ratio: Optional[components.VideoGenerationRequestAspectRatio] = None,
         callback_url: Optional[str] = None,
         duration: Optional[int] = None,
         frame_images: Optional[
@@ -241,7 +241,7 @@ async def generate_async(
                 components.VideoGenerationRequestProviderTypedDict,
             ]
         ] = None,
-        resolution: Optional[components.Resolution] = None,
+        resolution: Optional[components.VideoGenerationRequestResolution] = None,
         seed: Optional[int] = None,
         size: Optional[str] = None,
         retries: OptionalNullable[utils.RetryConfig] = UNSET,
diff --git a/uv.lock b/uv.lock
index ac18dd79..0bfff321 100644
--- a/uv.lock
+++ b/uv.lock
@@ -220,7 +220,7 @@ wheels = [
 
 [[package]]
 name = "openrouter"
-version = "0.10.0"
+version = "0.10.1"
 source = { editable = "." }
 dependencies = [
     { name = "httpcore" },